BLASTX nr result
ID: Angelica23_contig00037705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037705 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17575.3| unnamed protein product [Vitis vinifera] 90 2e-16 ref|XP_002269078.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_002525094.1| pentatricopeptide repeat-containing protein,... 80 2e-13 ref|XP_004165472.1| PREDICTED: pentatricopeptide repeat-containi... 78 7e-13 ref|XP_004148464.1| PREDICTED: pentatricopeptide repeat-containi... 78 7e-13 >emb|CBI17575.3| unnamed protein product [Vitis vinifera] Length = 656 Score = 89.7 bits (221), Expect = 2e-16 Identities = 45/73 (61%), Positives = 54/73 (73%) Frame = -2 Query: 221 GCVGKPVLAAKIFDLLPDDQKSTAAYTALISANLSCGDTGKGLQTYKIMRTKGIPSALGA 42 GC +P AAK+F LLPDDQK TAAYTALISA S G+ KGL+ YK M+ K I ALG Sbjct: 543 GCARRPGSAAKVFGLLPDDQKGTAAYTALISAYFSSGNVDKGLKIYKTMQRKRIHPALGT 602 Query: 41 YNVLLSGLERCGK 3 YN+LL+GLE+ G+ Sbjct: 603 YNLLLAGLEKKGR 615 >ref|XP_002269078.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Vitis vinifera] Length = 519 Score = 89.7 bits (221), Expect = 2e-16 Identities = 45/73 (61%), Positives = 54/73 (73%) Frame = -2 Query: 221 GCVGKPVLAAKIFDLLPDDQKSTAAYTALISANLSCGDTGKGLQTYKIMRTKGIPSALGA 42 GC +P AAK+F LLPDDQK TAAYTALISA S G+ KGL+ YK M+ K I ALG Sbjct: 406 GCARRPGSAAKVFGLLPDDQKGTAAYTALISAYFSSGNVDKGLKIYKTMQRKRIHPALGT 465 Query: 41 YNVLLSGLERCGK 3 YN+LL+GLE+ G+ Sbjct: 466 YNLLLAGLEKKGR 478 >ref|XP_002525094.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535553|gb|EEF37221.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 472 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/73 (53%), Positives = 48/73 (65%) Frame = -2 Query: 221 GCVGKPVLAAKIFDLLPDDQKSTAAYTALISANLSCGDTGKGLQTYKIMRTKGIPSALGA 42 G +P AAKIFDLLPD+QK TA YTA+I S G K L+ YK M+ I +LG Sbjct: 359 GSARRPNCAAKIFDLLPDEQKCTATYTAMIGVYFSAGSAAKALKIYKTMKKNSINPSLGT 418 Query: 41 YNVLLSGLERCGK 3 YNVLL+GLE+ G+ Sbjct: 419 YNVLLAGLEKSGR 431 >ref|XP_004165472.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Cucumis sativus] Length = 737 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/73 (49%), Positives = 50/73 (68%) Frame = -2 Query: 221 GCVGKPVLAAKIFDLLPDDQKSTAAYTALISANLSCGDTGKGLQTYKIMRTKGIPSALGA 42 G GKP A K+F++LP++ K TA YTAL+ S G +GKGL+ ++ MR KG +LG Sbjct: 541 GKAGKPQYARKVFNMLPEELKCTATYTALVDGYFSAGSSGKGLKIFETMRKKGFTPSLGT 600 Query: 41 YNVLLSGLERCGK 3 YNVLL+GL + G+ Sbjct: 601 YNVLLNGLAKNGR 613 >ref|XP_004148464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Cucumis sativus] Length = 1058 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/73 (49%), Positives = 50/73 (68%) Frame = -2 Query: 221 GCVGKPVLAAKIFDLLPDDQKSTAAYTALISANLSCGDTGKGLQTYKIMRTKGIPSALGA 42 G GKP A K+F++LP++ K TA YTAL+ S G +GKGL+ ++ MR KG +LG Sbjct: 522 GKAGKPQYARKVFNMLPEELKCTATYTALVDGYFSAGSSGKGLKIFETMRKKGFTPSLGT 581 Query: 41 YNVLLSGLERCGK 3 YNVLL+GL + G+ Sbjct: 582 YNVLLNGLAKNGR 594