BLASTX nr result
ID: Angelica23_contig00037578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037578 (513 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265350.2| PREDICTED: probable peptide/nitrate transpor... 72 4e-11 emb|CAN77701.1| hypothetical protein VITISV_011385 [Vitis vinifera] 72 4e-11 emb|CBI16981.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002329171.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_003592869.1| Peptide transporter PTR1 [Medicago truncatul... 66 3e-09 >ref|XP_002265350.2| PREDICTED: probable peptide/nitrate transporter At1g59740-like [Vitis vinifera] Length = 592 Score = 72.4 bits (176), Expect = 4e-11 Identities = 36/62 (58%), Positives = 43/62 (69%) Frame = +2 Query: 44 FYWLLAALSLVNFFNYLFWSRWYSYNPSLSLTIARNQPHEIQESDNQNIINASAKNSVDI 223 FYWLLAALSL+NFFNYLFWSRWYSYNPSLS T +Q E + +N+S + + D Sbjct: 533 FYWLLAALSLINFFNYLFWSRWYSYNPSLSPT---SQHGSYAEDLENHSLNSSKQIAADN 589 Query: 224 KI 229 I Sbjct: 590 NI 591 >emb|CAN77701.1| hypothetical protein VITISV_011385 [Vitis vinifera] Length = 650 Score = 72.4 bits (176), Expect = 4e-11 Identities = 36/62 (58%), Positives = 43/62 (69%) Frame = +2 Query: 44 FYWLLAALSLVNFFNYLFWSRWYSYNPSLSLTIARNQPHEIQESDNQNIINASAKNSVDI 223 FYWLLAALSL+NFFNYLFWSRWYSYNPSLS T +Q E + +N+S + + D Sbjct: 591 FYWLLAALSLINFFNYLFWSRWYSYNPSLSPT---SQHGSYAEDLENHSLNSSKQIAADN 647 Query: 224 KI 229 I Sbjct: 648 NI 649 >emb|CBI16981.3| unnamed protein product [Vitis vinifera] Length = 876 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 44 FYWLLAALSLVNFFNYLFWSRWYSYNPSLSLT 139 FYWLLAALSL+NFFNYLFWSRWYSYNPSLS T Sbjct: 504 FYWLLAALSLINFFNYLFWSRWYSYNPSLSPT 535 >ref|XP_002329171.1| predicted protein [Populus trichocarpa] gi|222870952|gb|EEF08083.1| predicted protein [Populus trichocarpa] Length = 600 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +2 Query: 44 FYWLLAALSLVNFFNYLFWSRWYSYNPSLSLTIARNQPHEIQ 169 FYWLLA LSL+NFFNYLFWS+WYSYNPSLS + Q E Q Sbjct: 544 FYWLLAVLSLINFFNYLFWSKWYSYNPSLSHDHSLGQDIESQ 585 >ref|XP_003592869.1| Peptide transporter PTR1 [Medicago truncatula] gi|92893694|gb|ABE91872.1| TGF-beta receptor, type I/II extracellular region; ABC transporter related [Medicago truncatula] gi|355481917|gb|AES63120.1| Peptide transporter PTR1 [Medicago truncatula] Length = 592 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 44 FYWLLAALSLVNFFNYLFWSRWYSYNPSLSLTIARNQPHEIQ 169 FYWLLA LS +NF NYLFWSRWYSYNPSLS + H ++ Sbjct: 538 FYWLLAVLSFLNFINYLFWSRWYSYNPSLSTISQEGEVHAME 579