BLASTX nr result
ID: Angelica23_contig00037503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037503 (535 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_23143178.1| hypothetical protein LEP2GSC003_RS09365, part... 67 1e-09 >ref|ZP_23143178.1| hypothetical protein LEP2GSC003_RS09365, partial [Leptospira interrogans serovar Manilae str. M776_fur_mutant] Length = 81 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = +3 Query: 384 VVNSGCSGHMTGNKALLSEYKEKAGPKVSYGDGNTGKTLGYGNINLGSV 530 +++SGCS HMTG+KALLS+++E AGP V++GD N G T+GYG I G+V Sbjct: 4 IIDSGCSRHMTGDKALLSQFEEMAGPLVTFGDNNKGFTMGYGKIVSGNV 52