BLASTX nr result
ID: Angelica23_contig00037358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037358 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520688.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 >ref|XP_002520688.1| conserved hypothetical protein [Ricinus communis] gi|223540073|gb|EEF41650.1| conserved hypothetical protein [Ricinus communis] Length = 170 Score = 63.5 bits (153), Expect = 2e-08 Identities = 38/60 (63%), Positives = 41/60 (68%), Gaps = 4/60 (6%) Frame = +1 Query: 181 AEESGKRPDGGNAITGPGA--ITSSGFGGLRLEGMRGSED*AGEGPAG--VGNRGVISGD 348 A+E+GK PDG TGPGA + SGFGGL LEGM GSED AGEG A VG G ISGD Sbjct: 52 ADEAGKDPDGEIPNTGPGASGLIISGFGGLGLEGMVGSEDSAGEGTAAPVVGKTGSISGD 111