BLASTX nr result
ID: Angelica23_contig00037205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037205 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274252.2| PREDICTED: coiled-coil domain-containing pro... 70 2e-10 emb|CBI22633.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_003533145.1| PREDICTED: coiled-coil domain-containing pro... 69 5e-10 ref|XP_003619414.1| Defensin/CCP-like protein [Medicago truncatu... 68 7e-10 ref|XP_002513641.1| conserved hypothetical protein [Ricinus comm... 68 7e-10 >ref|XP_002274252.2| PREDICTED: coiled-coil domain-containing protein 111 homolog [Vitis vinifera] Length = 632 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -2 Query: 121 CFRLPLSSKVGKSSMLLPSGHFKCRDMSEEDMFMASLICN 2 CFRL LSSK GK+S+LLP+G FKC+DM EE+MFMASLICN Sbjct: 338 CFRLALSSKAGKNSVLLPTGRFKCKDMCEEEMFMASLICN 377 >emb|CBI22633.3| unnamed protein product [Vitis vinifera] Length = 606 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -2 Query: 121 CFRLPLSSKVGKSSMLLPSGHFKCRDMSEEDMFMASLICN 2 CFRL LSSK GK+S+LLP+G FKC+DM EE+MFMASLICN Sbjct: 312 CFRLALSSKAGKNSVLLPTGRFKCKDMCEEEMFMASLICN 351 >ref|XP_003533145.1| PREDICTED: coiled-coil domain-containing protein 111 homolog [Glycine max] Length = 634 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 121 CFRLPLSSKVGKSSMLLPSGHFKCRDMSEEDMFMASLICN 2 CFRLPLSSK GK S+LLP+ FKC+D+ EED+FMASLICN Sbjct: 342 CFRLPLSSKAGKRSVLLPTKRFKCKDLGEEDIFMASLICN 381 >ref|XP_003619414.1| Defensin/CCP-like protein [Medicago truncatula] gi|355494429|gb|AES75632.1| Defensin/CCP-like protein [Medicago truncatula] Length = 687 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -2 Query: 121 CFRLPLSSKVGKSSMLLPSGHFKCRDMSEEDMFMASLICN 2 CFRL LSSK GKSS+LLP+ FKC+++SEEDMFMASLICN Sbjct: 341 CFRLHLSSKAGKSSILLPTERFKCKNLSEEDMFMASLICN 380 >ref|XP_002513641.1| conserved hypothetical protein [Ricinus communis] gi|223547549|gb|EEF49044.1| conserved hypothetical protein [Ricinus communis] Length = 601 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 118 FRLPLSSKVGKSSMLLPSGHFKCRDMSEEDMFMASLICN 2 FRL LSSK GK+S+LLP+G FKC+DM EEDMFMASLICN Sbjct: 319 FRLALSSKAGKNSVLLPTGRFKCKDMCEEDMFMASLICN 357