BLASTX nr result
ID: Angelica23_contig00037201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037201 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003578221.1| PREDICTED: calcium-transporting ATPase 1, pl... 66 3e-09 ref|XP_003578220.1| PREDICTED: calcium-transporting ATPase 1, pl... 66 3e-09 ref|XP_002510102.1| cation-transporting atpase plant, putative [... 65 4e-09 ref|XP_003611588.1| Calcium-transporting ATPase 2, plasma membra... 65 6e-09 ref|XP_002304320.1| autoinhibited calcium ATPase [Populus tricho... 65 6e-09 >ref|XP_003578221.1| PREDICTED: calcium-transporting ATPase 1, plasma membrane-type-like isoform 2 [Brachypodium distachyon] Length = 1005 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 108 PVFREKNLEELREIVPKIQVMARSSPLDKHTLVKHL 1 P FREK+LEEL E++PKIQVMARSSPLDKHTLVKHL Sbjct: 709 PEFREKSLEELLELIPKIQVMARSSPLDKHTLVKHL 744 >ref|XP_003578220.1| PREDICTED: calcium-transporting ATPase 1, plasma membrane-type-like isoform 1 [Brachypodium distachyon] Length = 1019 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 108 PVFREKNLEELREIVPKIQVMARSSPLDKHTLVKHL 1 P FREK+LEEL E++PKIQVMARSSPLDKHTLVKHL Sbjct: 709 PEFREKSLEELLELIPKIQVMARSSPLDKHTLVKHL 744 >ref|XP_002510102.1| cation-transporting atpase plant, putative [Ricinus communis] gi|223550803|gb|EEF52289.1| cation-transporting atpase plant, putative [Ricinus communis] Length = 916 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 108 PVFREKNLEELREIVPKIQVMARSSPLDKHTLVKHL 1 P FREK+ EELRE++PKIQVMARSSP+DKHTLVKHL Sbjct: 606 PEFREKSEEELRELIPKIQVMARSSPMDKHTLVKHL 641 >ref|XP_003611588.1| Calcium-transporting ATPase 2, plasma membrane-type [Medicago truncatula] gi|355512923|gb|AES94546.1| Calcium-transporting ATPase 2, plasma membrane-type [Medicago truncatula] Length = 1039 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 108 PVFREKNLEELREIVPKIQVMARSSPLDKHTLVKHL 1 P FREK+LEEL E++PKIQVMARSSPLDKHTLV+HL Sbjct: 732 PEFREKSLEELLELIPKIQVMARSSPLDKHTLVRHL 767 >ref|XP_002304320.1| autoinhibited calcium ATPase [Populus trichocarpa] gi|222841752|gb|EEE79299.1| autoinhibited calcium ATPase [Populus trichocarpa] Length = 1012 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 108 PVFREKNLEELREIVPKIQVMARSSPLDKHTLVKHL 1 P FREK+LEEL ++VPKIQVMARSSPLDKHTLVKHL Sbjct: 709 PDFREKSLEELLQLVPKIQVMARSSPLDKHTLVKHL 744