BLASTX nr result
ID: Angelica23_contig00037031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00037031 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631927.1| PREDICTED: uncharacterized protein LOC100854... 58 9e-07 ref|XP_002317632.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_002528523.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_003631927.1| PREDICTED: uncharacterized protein LOC100854263 [Vitis vinifera] Length = 125 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 370 RLRSFGRSNSFYSEAIADCLEFIKRSSAGVND 275 R RSFGR+NSFYSEAIADCLEFIKRSS V+D Sbjct: 84 RFRSFGRTNSFYSEAIADCLEFIKRSSLSVDD 115 >ref|XP_002317632.1| predicted protein [Populus trichocarpa] gi|222860697|gb|EEE98244.1| predicted protein [Populus trichocarpa] Length = 129 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -2 Query: 376 QNRLRSFGRSNSFYSEAIADCLEFIKRSSAGV 281 Q R RSFGRSNSFYSEAIADCLEFIKRSS V Sbjct: 90 QYRFRSFGRSNSFYSEAIADCLEFIKRSSISV 121 >ref|XP_002528523.1| conserved hypothetical protein [Ricinus communis] gi|223532025|gb|EEF33835.1| conserved hypothetical protein [Ricinus communis] Length = 127 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 370 RLRSFGRSNSFYSEAIADCLEFIKRSSAGV 281 R+R+FGRSNSFYSEAIADCLEFIKRSS V Sbjct: 90 RMRTFGRSNSFYSEAIADCLEFIKRSSISV 119