BLASTX nr result
ID: Angelica23_contig00036845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00036845 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309575.1| predicted protein [Populus trichocarpa] gi|2... 143 1e-32 ref|XP_002281549.1| PREDICTED: putative pentatricopeptide repeat... 142 3e-32 ref|XP_003523727.1| PREDICTED: putative pentatricopeptide repeat... 121 7e-26 ref|NP_188131.1| pentatricopeptide repeat-containing protein [Ar... 120 1e-25 gb|ACN28724.1| unknown [Zea mays] 116 2e-24 >ref|XP_002309575.1| predicted protein [Populus trichocarpa] gi|222855551|gb|EEE93098.1| predicted protein [Populus trichocarpa] Length = 653 Score = 143 bits (361), Expect = 1e-32 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = -2 Query: 279 LRVHSEKLAIGLALLCGGMEKGGKPIRIFKNLRVCGDCHEFIKGLSKILSKVFVVRDANR 100 LRVHSEKLAIGLAL+CGG+E+G K IR+FKNLRVCGDCHEFIKGLSKIL VFVVRDANR Sbjct: 579 LRVHSEKLAIGLALVCGGLEEGRKVIRVFKNLRVCGDCHEFIKGLSKILRVVFVVRDANR 638 Query: 99 FHKFEDGLCSCKDYW 55 FH+FEDGLCSC+DYW Sbjct: 639 FHRFEDGLCSCRDYW 653 >ref|XP_002281549.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Vitis vinifera] gi|296083673|emb|CBI23662.3| unnamed protein product [Vitis vinifera] Length = 685 Score = 142 bits (358), Expect = 3e-32 Identities = 66/75 (88%), Positives = 69/75 (92%) Frame = -2 Query: 279 LRVHSEKLAIGLALLCGGMEKGGKPIRIFKNLRVCGDCHEFIKGLSKILSKVFVVRDANR 100 LRVHSEKLAIGLAL+C GMEK G IR+FKNLRVCGDCHEFIKGLSKIL KVFVVRDANR Sbjct: 611 LRVHSEKLAIGLALVCDGMEKKGGVIRVFKNLRVCGDCHEFIKGLSKILKKVFVVRDANR 670 Query: 99 FHKFEDGLCSCKDYW 55 FH+FEDGLCSC DYW Sbjct: 671 FHRFEDGLCSCGDYW 685 >ref|XP_003523727.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130-like [Glycine max] Length = 586 Score = 121 bits (303), Expect = 7e-26 Identities = 58/76 (76%), Positives = 65/76 (85%), Gaps = 1/76 (1%) Frame = -2 Query: 279 LRVHSEKLAIGLALLCGGME-KGGKPIRIFKNLRVCGDCHEFIKGLSKILSKVFVVRDAN 103 LRVHSEKLAIGL L+ G++ KG + IRIFKNLRVCGDCH FIKGLSK+L FVVRDAN Sbjct: 511 LRVHSEKLAIGLVLVRRGLKLKGERVIRIFKNLRVCGDCHAFIKGLSKVLKIAFVVRDAN 570 Query: 102 RFHKFEDGLCSCKDYW 55 RFH+FE+GLCSC DYW Sbjct: 571 RFHRFENGLCSCGDYW 586 >ref|NP_188131.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546753|sp|P0C898.1|PP232_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g15130 gi|332642102|gb|AEE75623.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 689 Score = 120 bits (300), Expect = 1e-25 Identities = 56/75 (74%), Positives = 60/75 (80%) Frame = -2 Query: 279 LRVHSEKLAIGLALLCGGMEKGGKPIRIFKNLRVCGDCHEFIKGLSKILSKVFVVRDANR 100 LR HSEKLAIGLAL GG+ + GK IR+FKNLRVC DCHEFIKGLSKI +VVRDA R Sbjct: 615 LRAHSEKLAIGLALATGGLNQKGKTIRVFKNLRVCVDCHEFIKGLSKITKIAYVVRDAVR 674 Query: 99 FHKFEDGLCSCKDYW 55 FH FEDG CSC DYW Sbjct: 675 FHSFEDGCCSCGDYW 689 >gb|ACN28724.1| unknown [Zea mays] Length = 460 Score = 116 bits (291), Expect = 2e-24 Identities = 52/77 (67%), Positives = 63/77 (81%), Gaps = 2/77 (2%) Frame = -2 Query: 279 LRVHSEKLAIGLALLCGGMEKGG--KPIRIFKNLRVCGDCHEFIKGLSKILSKVFVVRDA 106 LR HSE+LA+GL LL G++ GG +PIR++KNLRVCGDCHEF KGLS ++ + VVRDA Sbjct: 384 LRAHSERLAVGLWLLRNGVDGGGHGEPIRVYKNLRVCGDCHEFFKGLSAVVRRALVVRDA 443 Query: 105 NRFHKFEDGLCSCKDYW 55 NRFH+FE G CSCKDYW Sbjct: 444 NRFHRFEHGSCSCKDYW 460