BLASTX nr result
ID: Angelica23_contig00036800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00036800 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18148.3| unnamed protein product [Vitis vinifera] 69 3e-10 ref|XP_003632605.1| PREDICTED: leucine-rich repeat receptor prot... 69 3e-10 gb|ACR33108.1| verticillium wilt disease resistance protein [Sol... 63 3e-08 ref|XP_003632604.1| PREDICTED: LRR receptor-like serine/threonin... 62 5e-08 emb|CAN76702.1| hypothetical protein VITISV_032508 [Vitis vinifera] 62 5e-08 >emb|CBI18148.3| unnamed protein product [Vitis vinifera] Length = 942 Score = 69.3 bits (168), Expect = 3e-10 Identities = 41/86 (47%), Positives = 53/86 (61%), Gaps = 5/86 (5%) Frame = -2 Query: 247 IPNWIWXXXXXXXXXXXLSVNQLEKLQEPY--VIHNLSSIDLRSNQLHGEVPIPLKNVYF 74 IPNWIW LS N LE LQEP+ +LSS+DL SNQLHG++P P + + Sbjct: 529 IPNWIWKIGNGSLMHLNLSHNLLEDLQEPFSNFTPDLSSLDLHSNQLHGQIPTPPQFSSY 588 Query: 73 LDYSNNFF-SSIPTNFN--LTSAIFF 5 +DYSNN F SSIP + ++ A+FF Sbjct: 589 VDYSNNSFNSSIPDDIGIYMSFALFF 614 >ref|XP_003632605.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Length = 988 Score = 69.3 bits (168), Expect = 3e-10 Identities = 41/86 (47%), Positives = 53/86 (61%), Gaps = 5/86 (5%) Frame = -2 Query: 247 IPNWIWXXXXXXXXXXXLSVNQLEKLQEPY--VIHNLSSIDLRSNQLHGEVPIPLKNVYF 74 IPNWIW LS N LE LQEP+ +LSS+DL SNQLHG++P P + + Sbjct: 575 IPNWIWKIGNGSLMHLNLSHNLLEDLQEPFSNFTPDLSSLDLHSNQLHGQIPTPPQFSSY 634 Query: 73 LDYSNNFF-SSIPTNFN--LTSAIFF 5 +DYSNN F SSIP + ++ A+FF Sbjct: 635 VDYSNNSFNSSIPDDIGIYMSFALFF 660 >gb|ACR33108.1| verticillium wilt disease resistance protein [Solanum lycopersicum] gi|237899611|gb|ACR33110.1| verticillium wilt disease resistance protein [Solanum lycopersicum] gi|237899613|gb|ACR33111.1| verticillium wilt disease resistance protein [Solanum lycopersicum] Length = 1139 Score = 62.8 bits (151), Expect = 3e-08 Identities = 37/85 (43%), Positives = 51/85 (60%), Gaps = 4/85 (4%) Frame = -2 Query: 247 IPNWIWXXXXXXXXXXXLSVNQLEKLQEPYVIH-NLSSIDLRSNQLHGEVPIPLKNVYFL 71 IPNWIW LS NQLE +++PY + NL+ +DL SN+L G++ IP ++ Sbjct: 568 IPNWIWGIGGGGLAHLNLSFNQLEYVEQPYTVSSNLAVLDLHSNRLKGDLLIPPSTAIYV 627 Query: 70 DY-SNNFFSSIPTNF--NLTSAIFF 5 DY SNN +SIPT+ +L A FF Sbjct: 628 DYSSNNLNNSIPTDIGRSLGFASFF 652 >ref|XP_003632604.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Length = 1070 Score = 62.0 bits (149), Expect = 5e-08 Identities = 39/87 (44%), Positives = 49/87 (56%), Gaps = 5/87 (5%) Frame = -2 Query: 250 DIPNWIWXXXXXXXXXXXLSVNQLEKLQEPYVIHN--LSSIDLRSNQLHGEVPIPLKNVY 77 +IPNWIW LS N LE LQEP LS +DL SNQLHG++P P + Sbjct: 571 NIPNWIWKIGNCSLAHLNLSHNLLEDLQEPLSNFTPYLSILDLHSNQLHGQIPTPPQFCS 630 Query: 76 FLDYSNN-FFSSIPTNFN--LTSAIFF 5 ++DYS+N F SSIP ++ IFF Sbjct: 631 YVDYSDNRFTSSIPDGIGVYISFTIFF 657 >emb|CAN76702.1| hypothetical protein VITISV_032508 [Vitis vinifera] Length = 1032 Score = 62.0 bits (149), Expect = 5e-08 Identities = 39/86 (45%), Positives = 49/86 (56%), Gaps = 5/86 (5%) Frame = -2 Query: 247 IPNWIWXXXXXXXXXXXLSVNQLEKLQEPYVIHN--LSSIDLRSNQLHGEVPIPLKNVYF 74 IPNWIW LS N LE LQE + LS +DL SNQLHG++P P + + Sbjct: 533 IPNWIWKIGNGSLMHLNLSHNLLEDLQETFSNFTPYLSILDLHSNQLHGQIPTPPQFSKY 592 Query: 73 LDYSNNFF-SSIPTNFN--LTSAIFF 5 +DYSNN F SSIP + ++ IFF Sbjct: 593 VDYSNNSFNSSIPDDIGTYMSFTIFF 618