BLASTX nr result
ID: Angelica23_contig00036797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00036797 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFR35658.1| hypothetical protein B739_1059 [Riemerella anatip... 69 5e-10 ref|ZP_07281461.1| conserved hypothetical protein [Streptomyces ... 63 2e-08 ref|ZP_08232407.1| TolA domain-containing protein [Actinomyces v... 59 4e-07 ref|ZP_08233496.1| TolA domain-containing protein [Actinomyces v... 59 4e-07 ref|ZP_08856823.1| hypothetical protein HMPREF9022_02480, partia... 49 5e-07 >gb|AFR35658.1| hypothetical protein B739_1059 [Riemerella anatipestifer RA-CH-1] Length = 157 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 151 LHTCYAPVRRSLISEETIPLGLHVLGLPLAFILSQDQ 261 +HTC APVRRS +SE+T+PLGLHVLGLPLAFILSQDQ Sbjct: 1 MHTCSAPVRRSQVSEDTLPLGLHVLGLPLAFILSQDQ 37 >ref|ZP_07281461.1| conserved hypothetical protein [Streptomyces sp. AA4] gi|302438014|gb|EFL09830.1| conserved hypothetical protein [Streptomyces sp. AA4] Length = 121 Score = 63.2 bits (152), Expect = 2e-08 Identities = 40/86 (46%), Positives = 48/86 (55%) Frame = +3 Query: 6 LVSRYLTN*LILRVPISIRRSFQY*TMPFNILWSINLPFERLSPR*RQVAHVLRTRTPLS 185 +V Y TN LI R I RR+F MP ++ I F LS Q+ HVL TR+PL Sbjct: 1 MVGHYPTNKLIGRGFIPYRRNFPPPQMPAVVVSGIRPSFPGLSQSTGQITHVLLTRSPLI 60 Query: 186 HFRRNNTARLACVRPPASVHPEPGSN 263 R + RLACV+ ASV PEPGSN Sbjct: 61 PGRNRFSVRLACVKHAASVRPEPGSN 86 >ref|ZP_08232407.1| TolA domain-containing protein [Actinomyces viscosus C505] gi|326637755|gb|EGE38657.1| TolA domain-containing protein [Actinomyces viscosus C505] Length = 177 Score = 58.9 bits (141), Expect = 4e-07 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = +1 Query: 100 YGVLIFLSKGYPPDKGRLHTCYAPVRRSLISEETI--PLGLHVLGLPLAFILSQDQ 261 Y VL LS GYP + GRL TCY+PVR S + + I P LHVL P AF+LSQDQ Sbjct: 51 YPVLATLSCGYPEEGGRLLTCYSPVRHSSRTSKLIPSPFDLHVLSTPPAFVLSQDQ 106 >ref|ZP_08233496.1| TolA domain-containing protein [Actinomyces viscosus C505] gi|326636353|gb|EGE37257.1| TolA domain-containing protein [Actinomyces viscosus C505] Length = 180 Score = 58.9 bits (141), Expect = 4e-07 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = +1 Query: 100 YGVLIFLSKGYPPDKGRLHTCYAPVRRSLISEETI--PLGLHVLGLPLAFILSQDQ 261 Y VL LS GYP + GRL TCY+PVR S + + I P LHVL P AF+LSQDQ Sbjct: 37 YPVLATLSCGYPEEGGRLLTCYSPVRHSSRTSKLIPSPFDLHVLSTPPAFVLSQDQ 92 >ref|ZP_08856823.1| hypothetical protein HMPREF9022_02480, partial [Erysipelotrichaceae bacterium 2_2_44A] gi|345905407|gb|EGX75147.1| hypothetical protein HMPREF9022_02480 [Erysipelotrichaceae bacterium 2_2_44A] Length = 196 Score = 48.9 bits (115), Expect(2) = 5e-07 Identities = 28/51 (54%), Positives = 33/51 (64%), Gaps = 3/51 (5%) Frame = +3 Query: 120 FERLSPR*RQVAHVLRTRTPLSHFRRNNT---ARLACVRPPASVHPEPGSN 263 F++LS QV +VL TR+PLS F RLAC+R ASVHPEPGSN Sbjct: 53 FQQLSRTHGQVTYVLLTRSPLSLFGSKLPRVFVRLACIRHAASVHPEPGSN 103 Score = 29.6 bits (65), Expect(2) = 5e-07 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 Query: 2 RLGEPLPHQLANLARAH 52 RLG PLPHQLAN + H Sbjct: 11 RLGGPLPHQLANAPQVH 27