BLASTX nr result
ID: Angelica23_contig00036719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00036719 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514582.1| inositol or phosphatidylinositol kinase, put... 59 4e-07 ref|XP_002311415.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 ref|XP_002316001.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002514582.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] gi|223546186|gb|EEF47688.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] Length = 647 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 3 VCMEARRLMAEREVFSPRVLAEDDGFQFDIDCEDVGFDFS 122 VCM+A+RL+AEREV SPR DD FQFDIDC ++ FDF+ Sbjct: 442 VCMDAKRLIAEREVLSPRTDLGDDEFQFDIDCGEIDFDFT 481 >ref|XP_002311415.1| predicted protein [Populus trichocarpa] gi|222851235|gb|EEE88782.1| predicted protein [Populus trichocarpa] Length = 611 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/41 (63%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +3 Query: 3 VCMEARRLMAEREVFSPR-VLAEDDGFQFDIDCEDVGFDFS 122 VC+EARRL+AEREVFSPR L +D FQFD+DC++ +DF+ Sbjct: 411 VCIEARRLIAEREVFSPRGYLGDDQDFQFDLDCDETHYDFT 451 >ref|XP_002316001.1| predicted protein [Populus trichocarpa] gi|222865041|gb|EEF02172.1| predicted protein [Populus trichocarpa] Length = 640 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/41 (60%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +3 Query: 3 VCMEARRLMAEREVFSPR-VLAEDDGFQFDIDCEDVGFDFS 122 VC+EARRL+AERE FSPR L +D FQFD+DC++ +DF+ Sbjct: 442 VCIEARRLIAEREAFSPRGDLGDDQEFQFDLDCDETQYDFT 482