BLASTX nr result
ID: Angelica23_contig00036685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00036685 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517636.1| PREDICTED: probable glutamate carboxypeptida... 62 2e-20 ref|XP_002309233.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-19 dbj|BAJ99016.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 9e-19 ref|XP_002871904.1| peptidase M28 family protein [Arabidopsis ly... 59 1e-18 ref|XP_002283565.2| PREDICTED: probable glutamate carboxypeptida... 60 2e-18 >ref|XP_003517636.1| PREDICTED: probable glutamate carboxypeptidase 2-like [Glycine max] Length = 693 Score = 62.4 bits (150), Expect(2) = 2e-20 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 FIILGNHRDAWTFGAADPNSGTAALLEVTLRL 98 F+ILGNHRDAWTFGA DPNSGTAALLEV RL Sbjct: 341 FVILGNHRDAWTFGAVDPNSGTAALLEVAQRL 372 Score = 61.2 bits (147), Expect(2) = 2e-20 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 187 VADRLGKLQKKGWKPRRTIIFCNWDAEEY 273 VA RLGKLQKKGW+PRRTI+ CNWDAEEY Sbjct: 368 VAQRLGKLQKKGWRPRRTILLCNWDAEEY 396 >ref|XP_002309233.1| predicted protein [Populus trichocarpa] gi|222855209|gb|EEE92756.1| predicted protein [Populus trichocarpa] Length = 709 Score = 62.4 bits (150), Expect(2) = 4e-19 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 FIILGNHRDAWTFGAADPNSGTAALLEVTLRL 98 F+ILGNHRDAWTFGA DPNSGTAALLEV RL Sbjct: 344 FVILGNHRDAWTFGAVDPNSGTAALLEVARRL 375 Score = 57.0 bits (136), Expect(2) = 4e-19 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 187 VADRLGKLQKKGWKPRRTIIFCNWDAEEY 273 VA RL KLQ+KGWKPRRTI+ CNWDAEEY Sbjct: 371 VARRLMKLQEKGWKPRRTIVLCNWDAEEY 399 >dbj|BAJ99016.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 751 Score = 61.6 bits (148), Expect(2) = 9e-19 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 FIILGNHRDAWTFGAADPNSGTAALLEVTLRL 98 ++ILGNHRDAWTFGAADPNSGTAALLE+ RL Sbjct: 388 YVILGNHRDAWTFGAADPNSGTAALLELAQRL 419 Score = 56.6 bits (135), Expect(2) = 9e-19 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 187 VADRLGKLQKKGWKPRRTIIFCNWDAEEY 273 +A RL KLQ KGW+PRRTII CNWDAEEY Sbjct: 415 LAQRLSKLQNKGWRPRRTIILCNWDAEEY 443 >ref|XP_002871904.1| peptidase M28 family protein [Arabidopsis lyrata subsp. lyrata] gi|297317741|gb|EFH48163.1| peptidase M28 family protein [Arabidopsis lyrata subsp. lyrata] Length = 682 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 FIILGNHRDAWTFGAADPNSGTAALLEVTLRL 98 ++ILGNHRDAWTFGA DPNSGTA LLE+ RL Sbjct: 326 YLILGNHRDAWTFGAVDPNSGTAVLLEIAQRL 357 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 187 VADRLGKLQKKGWKPRRTIIFCNWDAEEY 273 +A RL KLQK+GWKPRRTII CNWDAEEY Sbjct: 353 IAQRLDKLQKRGWKPRRTIILCNWDAEEY 381 >ref|XP_002283565.2| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 1 [Vitis vinifera] Length = 704 Score = 60.1 bits (144), Expect(2) = 2e-18 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 FIILGNHRDAWTFGAADPNSGTAALLEVTLRL 98 F++LGNHRDAWTFGA DPNSGTA LLEV RL Sbjct: 339 FVLLGNHRDAWTFGAVDPNSGTATLLEVAQRL 370 Score = 57.4 bits (137), Expect(2) = 2e-18 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 187 VADRLGKLQKKGWKPRRTIIFCNWDAEEY 273 VA RL KLQK+GW+PRRTI+ CNWDAEEY Sbjct: 366 VAQRLRKLQKRGWRPRRTIVLCNWDAEEY 394