BLASTX nr result
ID: Angelica23_contig00036575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00036575 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278239.1| PREDICTED: MADS-box transcription factor 26 ... 63 2e-08 emb|CAN74324.1| hypothetical protein VITISV_018011 [Vitis vinifera] 63 2e-08 ref|XP_004171563.1| PREDICTED: agamous-like MADS-box protein AGL... 63 3e-08 ref|NP_001233764.1| TAGL12 transcription factor [Solanum lycoper... 63 3e-08 ref|XP_003533515.1| PREDICTED: agamous-like MADS-box protein AGL... 62 6e-08 >ref|XP_002278239.1| PREDICTED: MADS-box transcription factor 26 [Vitis vinifera] gi|296089407|emb|CBI39226.3| unnamed protein product [Vitis vinifera] Length = 198 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 162 MVRGKIQMKRIENPVHRQVTFCKRRAGLLKQ 254 M RGKIQMKRIENPVHRQVTFCKRRAGLLK+ Sbjct: 1 MARGKIQMKRIENPVHRQVTFCKRRAGLLKK 31 >emb|CAN74324.1| hypothetical protein VITISV_018011 [Vitis vinifera] Length = 129 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 162 MVRGKIQMKRIENPVHRQVTFCKRRAGLLKQ 254 M RGKIQMKRIENPVHRQVTFCKRRAGLLK+ Sbjct: 1 MARGKIQMKRIENPVHRQVTFCKRRAGLLKK 31 >ref|XP_004171563.1| PREDICTED: agamous-like MADS-box protein AGL12-like, partial [Cucumis sativus] Length = 89 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 162 MVRGKIQMKRIENPVHRQVTFCKRRAGLLKQ 254 M RGK+QMKRIENPVHRQVTFCKRRAGLLK+ Sbjct: 1 MARGKVQMKRIENPVHRQVTFCKRRAGLLKK 31 >ref|NP_001233764.1| TAGL12 transcription factor [Solanum lycopersicum] gi|24967140|gb|AAM33103.2| TAGL12 transcription factor [Solanum lycopersicum] Length = 201 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 162 MVRGKIQMKRIENPVHRQVTFCKRRAGLLKQ 254 M RGK+QMKRIENPVHRQVTFCKRRAGLLK+ Sbjct: 1 MARGKVQMKRIENPVHRQVTFCKRRAGLLKK 31 >ref|XP_003533515.1| PREDICTED: agamous-like MADS-box protein AGL12-like [Glycine max] Length = 203 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 162 MVRGKIQMKRIENPVHRQVTFCKRRAGLLKQ 254 M RGK+Q+KRIENPVHRQVTFCKRRAGLLK+ Sbjct: 1 MARGKVQLKRIENPVHRQVTFCKRRAGLLKK 31