BLASTX nr result
ID: Angelica23_contig00036568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00036568 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidac... 122 2e-26 ref|ZP_07286019.1| conserved hypothetical protein [Streptomyces ... 109 2e-22 ref|ZP_06706815.1| hypothetical protein SSTG_00255 [Streptomyces... 106 2e-21 ref|ZP_06710336.1| hypothetical protein SSTG_03777 [Streptomyces... 102 3e-20 ref|ZP_07312206.1| hypothetical protein SSRG_03379 [Streptomyces... 100 2e-19 >ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] gi|325947935|gb|EGD40054.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] Length = 86 Score = 122 bits (307), Expect = 2e-26 Identities = 62/88 (70%), Positives = 70/88 (79%) Frame = -2 Query: 285 MWPVTLSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQ 106 MWPVTLSGRLPV+ALVSHY TNKLI RE IP R+ F MQ+ ++SGI+ F LSQS Sbjct: 1 MWPVTLSGRLPVEALVSHYLTNKLIGREHIPGRKTFHNHPMQEVVVSGINHRFRWLSQSL 60 Query: 105 GQVTHVLLTRSPLEHPTKAGPFRSTCMC 22 GQ+THVLLTRSPLE+P GPFRSTCMC Sbjct: 61 GQITHVLLTRSPLEYP--EGPFRSTCMC 86 >ref|ZP_07286019.1| conserved hypothetical protein [Streptomyces sp. C] gi|302442572|gb|EFL14388.1| conserved hypothetical protein [Streptomyces sp. C] Length = 84 Score = 109 bits (273), Expect = 2e-22 Identities = 58/86 (67%), Positives = 63/86 (73%) Frame = -2 Query: 279 PVTLSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQ 100 PV LSGRLPV ALV HYPTNKLI R I +RR+F P MQ +LSGI P F LSQS+GQ Sbjct: 1 PVALSGRLPVVALVGHYPTNKLIGRGLILHRRSFQLPPMQAGVLSGIRPRFQGLSQSEGQ 60 Query: 99 VTHVLLTRSPLEHPTKAGPFRSTCMC 22 + HVLLTRSPL HP G RSTCMC Sbjct: 61 IAHVLLTRSPLIHP--EGLHRSTCMC 84 >ref|ZP_06706815.1| hypothetical protein SSTG_00255 [Streptomyces sp. e14] gi|292831588|gb|EFF89937.1| hypothetical protein SSTG_00255 [Streptomyces sp. e14] Length = 86 Score = 106 bits (265), Expect = 2e-21 Identities = 58/88 (65%), Positives = 65/88 (73%) Frame = -2 Query: 285 MWPVTLSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQ 106 MWPV LSGRLPV ALVSHY TNKLI R I +RR+FP M + L+SGI P F LSQS+ Sbjct: 1 MWPVALSGRLPVVALVSHYLTNKLIGRGLILHRRSFPASKMPRRLVSGIRPRFQGLSQSE 60 Query: 105 GQVTHVLLTRSPLEHPTKAGPFRSTCMC 22 GQ+ HVLLTRSPL PT+ RSTCMC Sbjct: 61 GQIAHVLLTRSPL-IPTEV-VHRSTCMC 86 >ref|ZP_06710336.1| hypothetical protein SSTG_03777 [Streptomyces sp. e14] gi|292835109|gb|EFF93458.1| hypothetical protein SSTG_03777 [Streptomyces sp. e14] Length = 86 Score = 102 bits (254), Expect = 3e-20 Identities = 57/88 (64%), Positives = 63/88 (71%) Frame = -2 Query: 285 MWPVTLSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQ 106 MWPV LSGRLPV ALVS Y TNKLI R I +RR+FP M L+SGI P F LSQS+ Sbjct: 1 MWPVALSGRLPVVALVSRYLTNKLIGRGLILHRRSFPASKMPWRLVSGIRPRFQGLSQSE 60 Query: 105 GQVTHVLLTRSPLEHPTKAGPFRSTCMC 22 GQ+ HVLLTRSPL PT+ RSTCMC Sbjct: 61 GQIAHVLLTRSPL-IPTEV-VHRSTCMC 86 >ref|ZP_07312206.1| hypothetical protein SSRG_03379 [Streptomyces griseoflavus Tu4000] gi|302477482|gb|EFL40575.1| hypothetical protein SSRG_03379 [Streptomyces griseoflavus Tu4000] Length = 86 Score = 100 bits (248), Expect = 2e-19 Identities = 56/88 (63%), Positives = 63/88 (71%) Frame = -2 Query: 285 MWPVTLSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQ 106 MWPV LSGRLPV ALVSHY TNKLI R I +RR+F M ++SGI P F LSQS+ Sbjct: 1 MWPVALSGRLPVVALVSHYLTNKLIGRGLILHRRSFQPLQMPAGVISGIRPRFQGLSQSE 60 Query: 105 GQVTHVLLTRSPLEHPTKAGPFRSTCMC 22 GQ+ HVLLTRSPL PT+ RSTCMC Sbjct: 61 GQIAHVLLTRSPL-IPTEV-VHRSTCMC 86