BLASTX nr result
ID: Angelica23_contig00036325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00036325 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509683.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 ref|XP_002299570.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002303556.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002874729.1| hypothetical protein ARALYDRAFT_490003 [Arab... 59 3e-07 ref|NP_567383.1| uncharacterized protein [Arabidopsis thaliana] ... 59 3e-07 >ref|XP_002509683.1| conserved hypothetical protein [Ricinus communis] gi|223549582|gb|EEF51070.1| conserved hypothetical protein [Ricinus communis] Length = 730 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/36 (69%), Positives = 34/36 (94%) Frame = -3 Query: 304 NHFNTMFKHGGKIYLLATDEVFLNQPNLVWEKLDDV 197 NHF+TMFK+ G++YLLATD+ +LNQP+LVWEKL++V Sbjct: 580 NHFSTMFKYDGELYLLATDQGYLNQPDLVWEKLNEV 615 >ref|XP_002299570.1| predicted protein [Populus trichocarpa] gi|222846828|gb|EEE84375.1| predicted protein [Populus trichocarpa] Length = 686 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/36 (66%), Positives = 34/36 (94%) Frame = -3 Query: 304 NHFNTMFKHGGKIYLLATDEVFLNQPNLVWEKLDDV 197 NHF+TMFK+ G++YLLATD+ ++NQP+LVWEKL++V Sbjct: 525 NHFSTMFKYDGELYLLATDQGYINQPDLVWEKLNEV 560 >ref|XP_002303556.1| predicted protein [Populus trichocarpa] gi|222840988|gb|EEE78535.1| predicted protein [Populus trichocarpa] Length = 596 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/36 (66%), Positives = 34/36 (94%) Frame = -3 Query: 304 NHFNTMFKHGGKIYLLATDEVFLNQPNLVWEKLDDV 197 NHF+TMFK+ G++YLLATD+ ++NQP+LVWEKL++V Sbjct: 439 NHFSTMFKYDGELYLLATDQGYINQPDLVWEKLNEV 474 >ref|XP_002874729.1| hypothetical protein ARALYDRAFT_490003 [Arabidopsis lyrata subsp. lyrata] gi|297320566|gb|EFH50988.1| hypothetical protein ARALYDRAFT_490003 [Arabidopsis lyrata subsp. lyrata] Length = 687 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -3 Query: 304 NHFNTMFKHGGKIYLLATDEVFLNQPNLVWEKLDDV 197 NHF TMFK+ G++YLLATD+ +LNQP+LVWEKL++V Sbjct: 526 NHFCTMFKYEGELYLLATDQGYLNQPDLVWEKLNEV 561 >ref|NP_567383.1| uncharacterized protein [Arabidopsis thaliana] gi|21553726|gb|AAM62819.1| unknown [Arabidopsis thaliana] gi|110738711|dbj|BAF01280.1| hypothetical protein [Arabidopsis thaliana] gi|332657659|gb|AEE83059.1| uncharacterized protein [Arabidopsis thaliana] Length = 682 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -3 Query: 304 NHFNTMFKHGGKIYLLATDEVFLNQPNLVWEKLDDV 197 NHF TMFK+ G++YLLATD+ +LNQP+LVWEKL++V Sbjct: 522 NHFCTMFKYEGELYLLATDQGYLNQPDLVWEKLNEV 557