BLASTX nr result
ID: Angelica23_contig00036300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00036300 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003618806.1| hypothetical protein MTR_6g023220 [Medicago ... 55 8e-06 >ref|XP_003618806.1| hypothetical protein MTR_6g023220 [Medicago truncatula] gi|355493821|gb|AES75024.1| hypothetical protein MTR_6g023220 [Medicago truncatula] Length = 372 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Frame = -1 Query: 243 LHLVPSNDQLYMVSYVQRETDKIIMIHRLDERLMEWEQVKNLGENALFVS-EGSRAVVNP 67 L L+ +NDQL++V +V K + I+ +D M W +V +LG+ ALF+ +G A+ P Sbjct: 243 LKLIVTNDQLFLVDFVPA---KHLNIYEMDFDTMMWIKVSDLGDKALFLGGKGHCAMRRP 299 Query: 66 TMWGGRSNCIYFL 28 WG SNC+Y+L Sbjct: 300 GKWGHLSNCVYYL 312