BLASTX nr result
ID: Angelica23_contig00035917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035917 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33369.3| unnamed protein product [Vitis vinifera] 55 5e-06 ref|XP_002285674.1| PREDICTED: non-lysosomal glucosylceramidase-... 55 5e-06 emb|CAN61188.1| hypothetical protein VITISV_019327 [Vitis vinifera] 55 5e-06 >emb|CBI33369.3| unnamed protein product [Vitis vinifera] Length = 508 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 98 MVSGSIFQYRKSSWPPEEYVNRPTLELLDSDSSA 199 MVSG+IF RK SWPPEEY+NR TL LLD DS+A Sbjct: 1 MVSGNIFHCRKHSWPPEEYINRTTLHLLDFDSAA 34 >ref|XP_002285674.1| PREDICTED: non-lysosomal glucosylceramidase-like [Vitis vinifera] Length = 978 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 98 MVSGSIFQYRKSSWPPEEYVNRPTLELLDSDSSA 199 MVSG+IF RK SWPPEEY+NR TL LLD DS+A Sbjct: 1 MVSGNIFHCRKHSWPPEEYINRTTLHLLDFDSAA 34 >emb|CAN61188.1| hypothetical protein VITISV_019327 [Vitis vinifera] Length = 550 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +2 Query: 98 MVSGSIFQYRKSSWPPEEYVNRPTLELLDSDSSA 199 MVSG+IF RK SWPPEEY+NR TL LLD DS+A Sbjct: 1 MVSGNIFHCRKHSWPPEEYINRTTLHLLDFDSAA 34