BLASTX nr result
ID: Angelica23_contig00035590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035590 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16416.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_002532405.1| DNA binding protein, putative [Ricinus commu... 56 3e-06 ref|XP_002323299.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002314023.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 ref|XP_002513187.1| DNA binding protein, putative [Ricinus commu... 55 6e-06 >emb|CBI16416.3| unnamed protein product [Vitis vinifera] Length = 297 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 MLDLAVDYIKDLQKEVKTLSHVRANCTCSSKQK 101 MLDLAVDYIKDLQK+VKTLS RA CTCS+KQK Sbjct: 264 MLDLAVDYIKDLQKQVKTLSDNRAKCTCSNKQK 296 >ref|XP_002532405.1| DNA binding protein, putative [Ricinus communis] gi|223527901|gb|EEF29990.1| DNA binding protein, putative [Ricinus communis] Length = 355 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +3 Query: 3 MLDLAVDYIKDLQKEVKTLSHVRANCTCSSKQK 101 MLDLAVDYIKDLQK+ KTLS RANC C SKQK Sbjct: 316 MLDLAVDYIKDLQKQYKTLSDNRANCKCLSKQK 348 >ref|XP_002323299.1| predicted protein [Populus trichocarpa] gi|222867929|gb|EEF05060.1| predicted protein [Populus trichocarpa] Length = 107 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +3 Query: 3 MLDLAVDYIKDLQKEVKTLSHVRANCTCSSKQK 101 MLDLAVDYIKDLQK+ KTLS RANC C SKQK Sbjct: 75 MLDLAVDYIKDLQKQYKTLSDNRANCKCLSKQK 107 >ref|XP_002314023.1| predicted protein [Populus trichocarpa] gi|222850431|gb|EEE87978.1| predicted protein [Populus trichocarpa] Length = 421 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 3 MLDLAVDYIKDLQKEVKTLSHVRANCTCSSKQK 101 MLDLAV++IKDLQK+VKTL+ +A CTCSSKQK Sbjct: 382 MLDLAVEHIKDLQKQVKTLTDTKAKCTCSSKQK 414 >ref|XP_002513187.1| DNA binding protein, putative [Ricinus communis] gi|223547685|gb|EEF49178.1| DNA binding protein, putative [Ricinus communis] Length = 432 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 3 MLDLAVDYIKDLQKEVKTLSHVRANCTCSSKQK 101 MLDLAV+YIKDLQK+VKTL +A CTC SKQK Sbjct: 395 MLDLAVEYIKDLQKQVKTLKDTKAKCTCPSKQK 427