BLASTX nr result
ID: Angelica23_contig00035579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035579 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270184.2| PREDICTED: pentatricopeptide repeat-containi... 73 2e-11 ref|XP_004141206.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_002270184.2| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Vitis vinifera] gi|298204537|emb|CBI23812.3| unnamed protein product [Vitis vinifera] Length = 659 Score = 73.2 bits (178), Expect = 2e-11 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 4/95 (4%) Frame = -2 Query: 273 PPPSFITYVSSTTSAAVPG---ESQFEHTNIS-TKYSQNSQASFKTRQNDAILDIQHSSD 106 P PS SS ++A P ESQ E T++S T + +K RQ+ AIL++Q SSD Sbjct: 29 PLPSTTRAKSSHLTSATPPLHKESQIEPTHVSVTPRKRCHSVGYKARQS-AILEVQQSSD 87 Query: 105 LGSALARSGGILRVEDLNTILRHFGKSQKLKKLSQ 1 LGSALAR G +L+V+DLN ILRHFGK + + LSQ Sbjct: 88 LGSALARLGDMLKVQDLNVILRHFGKLCRWQDLSQ 122 >ref|XP_004141206.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like [Cucumis sativus] Length = 668 Score = 55.8 bits (133), Expect = 3e-06 Identities = 35/85 (41%), Positives = 49/85 (57%), Gaps = 4/85 (4%) Frame = -2 Query: 243 STTSAAVPGESQFEHTNISTKYSQNSQA----SFKTRQNDAILDIQHSSDLGSALARSGG 76 S + A +P E QF + + K +Q S+ RQ+ AI ++ S+L ALAR GG Sbjct: 41 SNSVAILPKEPQFLPGSSNAKLINGAQKRHSKSYLERQS-AIAQVKDCSELAPALARYGG 99 Query: 75 ILRVEDLNTILRHFGKSQKLKKLSQ 1 +L+ +DLN ILRHFG + K LSQ Sbjct: 100 LLKAQDLNVILRHFGMLSRWKDLSQ 124