BLASTX nr result
ID: Angelica23_contig00035562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035562 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20465.3| unnamed protein product [Vitis vinifera] 129 3e-28 ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthe... 129 3e-28 ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthe... 129 3e-28 ref|XP_003526154.1| PREDICTED: indole-3-acetic acid-amido synthe... 128 4e-28 ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6,... 128 5e-28 >emb|CBI20465.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 129 bits (323), Expect = 3e-28 Identities = 58/65 (89%), Positives = 62/65 (95%) Frame = -2 Query: 312 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPKCPKWVPGHKQ 133 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVVS+Y SPKCPKW+PGHKQ Sbjct: 505 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQ 564 Query: 132 WMDIN 118 W + N Sbjct: 565 WCNKN 569 >ref|XP_002283236.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 2 [Vitis vinifera] Length = 596 Score = 129 bits (323), Expect = 3e-28 Identities = 58/65 (89%), Positives = 62/65 (95%) Frame = -2 Query: 312 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPKCPKWVPGHKQ 133 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVVS+Y SPKCPKW+PGHKQ Sbjct: 532 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQ 591 Query: 132 WMDIN 118 W + N Sbjct: 592 WCNKN 596 >ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 1 [Vitis vinifera] gi|147866579|emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera] Length = 613 Score = 129 bits (323), Expect = 3e-28 Identities = 58/65 (89%), Positives = 62/65 (95%) Frame = -2 Query: 312 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPKCPKWVPGHKQ 133 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPI+ELLNSRVVS+Y SPKCPKW+PGHKQ Sbjct: 549 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPIIELLNSRVVSNYFSPKCPKWIPGHKQ 608 Query: 132 WMDIN 118 W + N Sbjct: 609 WCNKN 613 >ref|XP_003526154.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine max] Length = 609 Score = 128 bits (322), Expect = 4e-28 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = -2 Query: 312 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPKCPKWVPGHKQ 133 VE GTFDKLMDYAISLGASINQYKTPRCVKFAP++ELLNSRVV Y SPKCPKWVPGHKQ Sbjct: 543 VEQGTFDKLMDYAISLGASINQYKTPRCVKFAPVLELLNSRVVEKYFSPKCPKWVPGHKQ 602 Query: 132 WMDINSS 112 W++ NSS Sbjct: 603 WINQNSS 609 >ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] gi|223526345|gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] Length = 612 Score = 128 bits (321), Expect = 5e-28 Identities = 60/65 (92%), Positives = 61/65 (93%) Frame = -2 Query: 312 VESGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYLSPKCPKWVPGHKQ 133 VE GTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSY SPKCPKWVPGHKQ Sbjct: 548 VEPGTFDKLMDYAISLGASINQYKTPRCVKFAPIVELLNSRVVSSYFSPKCPKWVPGHKQ 607 Query: 132 WMDIN 118 W + N Sbjct: 608 WGNKN 612