BLASTX nr result
ID: Angelica23_contig00035378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035378 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541805.1| PREDICTED: FBD-associated F-box protein At3g... 60 1e-07 ref|XP_003610666.1| F-box/LRR-repeat protein [Medicago truncatul... 56 3e-06 ref|NP_197653.2| F-box, FBD and leucine rich repeat domain-conta... 56 3e-06 ref|XP_003596628.1| F-box/LRR-repeat protein [Medicago truncatul... 56 3e-06 sp|Q9FNK0.1|FDL30_ARATH RecName: Full=Putative F-box/FBD/LRR-rep... 56 3e-06 >ref|XP_003541805.1| PREDICTED: FBD-associated F-box protein At3g52670-like [Glycine max] Length = 639 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/56 (51%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = -1 Query: 211 SNKQDIDISSILPEAVFSNIVSWLPVKEAVRTSVLVKRWKHAWKYVTRL---DLDP 53 SN + DI S LP+ + I+S LP KEAVRTS+L KRW++ WK+VT+L D++P Sbjct: 267 SNYEGQDIFSDLPDVIIGRILSILPTKEAVRTSILSKRWRNLWKFVTKLHFQDIEP 322 >ref|XP_003610666.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355512001|gb|AES93624.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 494 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/66 (36%), Positives = 44/66 (66%) Frame = -1 Query: 211 SNKQDIDISSILPEAVFSNIVSWLPVKEAVRTSVLVKRWKHAWKYVTRLDLDPESISEPY 32 +N + IS++LPE V ++I+S++P K+A+RTS+L K+W+ W +T+L L +S + Sbjct: 26 ANAVEDTISNMLPEPVITHILSFVPTKDAIRTSILSKKWERRWTSITKLSLHDYQLSFDF 85 Query: 31 VEHVRR 14 ++R Sbjct: 86 TIRLKR 91 >ref|NP_197653.2| F-box, FBD and leucine rich repeat domain-containing protein [Arabidopsis thaliana] gi|332005668|gb|AED93051.1| F-box, FBD and leucine rich repeat domain-containing protein [Arabidopsis thaliana] Length = 472 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -1 Query: 193 DISSILPEAVFSNIVSWLPVKEAVRTSVLVKRWKHAWKYVTRLDLD 56 D+ S LPE + S I+S+LP K+ VRTSVL KRWK W + LDLD Sbjct: 18 DLISKLPEVLLSQILSYLPTKDIVRTSVLSKRWKSVWLLIPGLDLD 63 >ref|XP_003596628.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355485676|gb|AES66879.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 123 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -1 Query: 193 DISSILPEAVFSNIVSWLPVKEAVRTSVLVKRWKHAWKYVTRLDLD 56 D+ S LP+ + I+ +LP KEAVRTSVL K+W + WK++T+LD D Sbjct: 27 DLISNLPDHIIGYILFFLPTKEAVRTSVLSKKWIYLWKFITKLDFD 72 >sp|Q9FNK0.1|FDL30_ARATH RecName: Full=Putative F-box/FBD/LRR-repeat protein At5g22610 gi|10178235|dbj|BAB11667.1| unnamed protein product [Arabidopsis thaliana] Length = 502 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -1 Query: 193 DISSILPEAVFSNIVSWLPVKEAVRTSVLVKRWKHAWKYVTRLDLD 56 D+ S LPE + S I+S+LP K+ VRTSVL KRWK W + LDLD Sbjct: 18 DLISKLPEVLLSQILSYLPTKDIVRTSVLSKRWKSVWLLIPGLDLD 63