BLASTX nr result
ID: Angelica23_contig00035355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035355 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520033.1| catalytic, putative [Ricinus communis] gi|22... 63 4e-11 ref|XP_004144725.1| PREDICTED: probable glucuronoxylan glucurono... 60 9e-11 ref|XP_004167395.1| PREDICTED: probable glucuronoxylan glucurono... 60 9e-11 ref|XP_002325382.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-10 ref|NP_197191.1| Exostosin family protein [Arabidopsis thaliana]... 56 3e-09 >ref|XP_002520033.1| catalytic, putative [Ricinus communis] gi|223540797|gb|EEF42357.1| catalytic, putative [Ricinus communis] Length = 507 Score = 62.8 bits (151), Expect(2) = 4e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 40 GKLVNIKLHTRRSQRVVKESRSLCFCDCKPAN 135 GKLVNIKLHTRRSQRVVKESRS+C CDCK AN Sbjct: 469 GKLVNIKLHTRRSQRVVKESRSVCTCDCKRAN 500 Score = 29.6 bits (65), Expect(2) = 4e-11 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 2 AQPSGPEDLAWRMVS 46 AQP GPEDL WRM++ Sbjct: 454 AQPLGPEDLVWRMMA 468 >ref|XP_004144725.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like [Cucumis sativus] Length = 518 Score = 60.5 bits (145), Expect(2) = 9e-11 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 40 GKLVNIKLHTRRSQRVVKESRSLCFCDCKPAN 135 GKLVNIKLHTRRSQRVVKESRS+C CDC+ +N Sbjct: 478 GKLVNIKLHTRRSQRVVKESRSVCSCDCRRSN 509 Score = 30.8 bits (68), Expect(2) = 9e-11 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 2 AQPSGPEDLAWRMV 43 AQP GPEDLAW+M+ Sbjct: 463 AQPMGPEDLAWKMI 476 >ref|XP_004167395.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like [Cucumis sativus] Length = 517 Score = 60.5 bits (145), Expect(2) = 9e-11 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 40 GKLVNIKLHTRRSQRVVKESRSLCFCDCKPAN 135 GKLVNIKLHTRRSQRVVKESRS+C CDC+ +N Sbjct: 478 GKLVNIKLHTRRSQRVVKESRSVCSCDCRRSN 509 Score = 30.8 bits (68), Expect(2) = 9e-11 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 2 AQPSGPEDLAWRMV 43 AQP GPEDLAW+M+ Sbjct: 463 AQPMGPEDLAWKMI 476 >ref|XP_002325382.1| predicted protein [Populus trichocarpa] gi|222862257|gb|EEE99763.1| predicted protein [Populus trichocarpa] Length = 505 Score = 61.6 bits (148), Expect(2) = 5e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 40 GKLVNIKLHTRRSQRVVKESRSLCFCDCKPAN 135 GKLVNI+LHTRRSQRVVKESRS+C CDCK AN Sbjct: 468 GKLVNIRLHTRRSQRVVKESRSVCACDCKRAN 499 Score = 26.9 bits (58), Expect(2) = 5e-10 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 2 AQPSGPEDLAWRMVS 46 A P GPEDL WRM++ Sbjct: 453 ALPLGPEDLVWRMMA 467 >ref|NP_197191.1| Exostosin family protein [Arabidopsis thaliana] gi|9755690|emb|CAC01702.1| putative protein [Arabidopsis thaliana] gi|15810401|gb|AAL07088.1| unknown protein [Arabidopsis thaliana] gi|23296585|gb|AAN13125.1| unknown protein [Arabidopsis thaliana] gi|332004972|gb|AED92355.1| Exostosin family protein [Arabidopsis thaliana] Length = 511 Score = 55.8 bits (133), Expect(2) = 3e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 40 GKLVNIKLHTRRSQRVVKESRSLCFCDCKPAN 135 GKLVNIKLHTRRSQRVVK SRS+C CDC +N Sbjct: 468 GKLVNIKLHTRRSQRVVKGSRSICRCDCWRSN 499 Score = 30.4 bits (67), Expect(2) = 3e-09 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 2 AQPSGPEDLAWRMVS 46 AQP GPEDL WRM++ Sbjct: 453 AQPLGPEDLTWRMIA 467