BLASTX nr result
ID: Angelica23_contig00035308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035308 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_002309173.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 emb|CAN63706.1| hypothetical protein VITISV_013107 [Vitis vinifera] 69 5e-10 ref|XP_003533674.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 >ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] gi|449483740|ref|XP_004156675.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] Length = 491 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/70 (54%), Positives = 53/70 (75%) Frame = -1 Query: 212 NFYLRKNRKWPLSPYNAKFQEKLNQQEALRALKQSASLLKPTHLLSSLIDSFTMYNCSTT 33 N +LRK+RKWPLS + K+ + +Q EALR LKQ+A+ +P LLS+L+ SFT Y+C T Sbjct: 12 NNFLRKHRKWPLSSHKTKWHQTFDQDEALRILKQAANPDQPHLLLSALVTSFTAYSCHPT 71 Query: 32 PHAYHFVIKT 3 P+AY+FV+KT Sbjct: 72 PNAYYFVLKT 81 >ref|XP_002309173.1| predicted protein [Populus trichocarpa] gi|222855149|gb|EEE92696.1| predicted protein [Populus trichocarpa] Length = 506 Score = 75.9 bits (185), Expect = 3e-12 Identities = 39/78 (50%), Positives = 53/78 (67%), Gaps = 8/78 (10%) Frame = -1 Query: 212 NFYLRKNRKWPLSPYNAKFQEKLNQQEALRALKQSASLLKP--------THLLSSLIDSF 57 +F+LRK+RKWP SPY A++ NQQ+A+++LKQSA LKP HLLSSLI SF Sbjct: 11 SFFLRKHRKWPYSPYKARWHRIFNQQQAMQSLKQSA--LKPPQQESPNKPHLLSSLIHSF 68 Query: 56 TMYNCSTTPHAYHFVIKT 3 ++Y+ P A+ F+ KT Sbjct: 69 SIYDVEPAPKAFDFIFKT 86 >ref|XP_002265961.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Vitis vinifera] Length = 505 Score = 68.6 bits (166), Expect = 5e-10 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 7/75 (9%) Frame = -1 Query: 206 YLRKNRKWPLSPYNAKFQEKLNQQEALRALK-----QSASLLKPTH--LLSSLIDSFTMY 48 +LRK RKWPLSPY A + E + ++A++ LK QS S P++ LS LIDSF +Y Sbjct: 12 FLRKRRKWPLSPYKATWHETFHHRQAMQTLKNTIANQSPSPQSPSNSQFLSILIDSFRIY 71 Query: 47 NCSTTPHAYHFVIKT 3 N TP+AY FVI T Sbjct: 72 NSDPTPNAYRFVIST 86 >emb|CAN63706.1| hypothetical protein VITISV_013107 [Vitis vinifera] Length = 390 Score = 68.6 bits (166), Expect = 5e-10 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 7/75 (9%) Frame = -1 Query: 206 YLRKNRKWPLSPYNAKFQEKLNQQEALRALK-----QSASLLKPTH--LLSSLIDSFTMY 48 +LRK RKWPLSPY A + E + ++A++ LK QS S P++ LS LIDSF +Y Sbjct: 14 FLRKRRKWPLSPYKATWHETFHHRQAMQTLKNTIANQSPSPQSPSNSQFLSILIDSFRIY 73 Query: 47 NCSTTPHAYHFVIKT 3 N TP+AY FVI T Sbjct: 74 NSDPTPNAYRFVIST 88 >ref|XP_003533674.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Glycine max] Length = 499 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 11/81 (13%) Frame = -1 Query: 212 NFYLRKNRKWPLSPYNAKFQEKLNQQEALRALKQSASLLKPTH-----------LLSSLI 66 N YLRK +KWP SPY + +++A++ LKQ+ + + LLS+L+ Sbjct: 11 NKYLRKFKKWPHSPYKTSWHHNFGEEQAMKNLKQATLEMDSSQHPQRPNLPCPFLLSTLL 70 Query: 65 DSFTMYNCSTTPHAYHFVIKT 3 DSF Y+ TP AY FV+KT Sbjct: 71 DSFKAYSIDPTPKAYFFVLKT 91