BLASTX nr result
ID: Angelica23_contig00035209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035209 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_967420.1| PREDICTED: similar to cullin [Tribolium castane... 59 4e-15 gb|ELU05517.1| hypothetical protein CAPTEDRAFT_217617 [Capitella... 59 5e-15 ref|XP_002432485.1| Cullin-3, putative [Pediculus humanus corpor... 58 9e-15 gb|EFN52532.1| hypothetical protein CHLNCDRAFT_138949 [Chlorella... 61 2e-14 ref|XP_002735887.1| PREDICTED: cullin 3-like [Saccoglossus kowal... 57 2e-14 >ref|XP_967420.1| PREDICTED: similar to cullin [Tribolium castaneum] gi|270007361|gb|EFA03809.1| hypothetical protein TcasGA2_TC013922 [Tribolium castaneum] Length = 771 Score = 58.9 bits (141), Expect(2) = 4e-15 Identities = 24/43 (55%), Positives = 38/43 (88%) Frame = +2 Query: 35 FIYLNPRCAEFMSVFVDNRLRKGVKGVSEEDFEVVLDKIMMLF 163 F+ LNP+ E++S+F+D++L+KGVKG+SE++ E+VLDK M+LF Sbjct: 379 FLNLNPKSPEYLSLFIDDKLKKGVKGMSEQEIELVLDKSMVLF 421 Score = 47.0 bits (110), Expect(2) = 4e-15 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 175 FSYLHEKDVFERYYKQHLAKRLLSGKN 255 F +L EKDVFERYYKQHLAKRLL K+ Sbjct: 421 FRFLQEKDVFERYYKQHLAKRLLLNKS 447 >gb|ELU05517.1| hypothetical protein CAPTEDRAFT_217617 [Capitella teleta] Length = 768 Score = 58.5 bits (140), Expect(2) = 5e-15 Identities = 24/43 (55%), Positives = 37/43 (86%) Frame = +2 Query: 35 FIYLNPRCAEFMSVFVDNRLRKGVKGVSEEDFEVVLDKIMMLF 163 FI +NP+ E++S+F+D++LRKGVKG++E++ E VLDK M+LF Sbjct: 373 FININPKSPEYLSLFIDDKLRKGVKGMTEQEIEAVLDKSMVLF 415 Score = 47.0 bits (110), Expect(2) = 5e-15 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 175 FSYLHEKDVFERYYKQHLAKRLLSGKN 255 F +L EKDVFERYYKQHLAKRLL K+ Sbjct: 415 FRFLQEKDVFERYYKQHLAKRLLLNKS 441 >ref|XP_002432485.1| Cullin-3, putative [Pediculus humanus corporis] gi|212517918|gb|EEB19747.1| Cullin-3, putative [Pediculus humanus corporis] Length = 607 Score = 57.8 bits (138), Expect(2) = 9e-15 Identities = 23/43 (53%), Positives = 37/43 (86%) Frame = +2 Query: 35 FIYLNPRCAEFMSVFVDNRLRKGVKGVSEEDFEVVLDKIMMLF 163 F+ LNP+ E++S+F+D++L+KGVKG++E++ E VLDK M+LF Sbjct: 372 FLNLNPKSPEYLSLFIDDKLKKGVKGMTEQEIETVLDKTMVLF 414 Score = 47.0 bits (110), Expect(2) = 9e-15 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 175 FSYLHEKDVFERYYKQHLAKRLLSGKN 255 F +L EKDVFERYYKQHLAKRLL K+ Sbjct: 414 FRFLQEKDVFERYYKQHLAKRLLLNKS 440 >gb|EFN52532.1| hypothetical protein CHLNCDRAFT_138949 [Chlorella variabilis] Length = 712 Score = 60.8 bits (146), Expect(2) = 2e-14 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = +2 Query: 35 FIYLNPRCAEFMSVFVDNRLRKGVKGVSEEDFEVVLDKIMMLF 163 F+ LNPR E++S+F+D++LRKG+KG+SE+D EVVLDK +MLF Sbjct: 367 FLNLNPRSPEYISLFMDDKLRKGLKGMSEDDIEVVLDKGIMLF 409 Score = 42.7 bits (99), Expect(2) = 2e-14 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 190 EKDVFERYYKQHLAKRLLSGKN 255 EKDVFE+YYKQHLAKRLL G++ Sbjct: 437 EKDVFEKYYKQHLAKRLLHGRS 458 >ref|XP_002735887.1| PREDICTED: cullin 3-like [Saccoglossus kowalevskii] Length = 671 Score = 56.6 bits (135), Expect(2) = 2e-14 Identities = 24/43 (55%), Positives = 37/43 (86%) Frame = +2 Query: 35 FIYLNPRCAEFMSVFVDNRLRKGVKGVSEEDFEVVLDKIMMLF 163 F+ LN + E++S+F+D++L+KGVKG+SE++ EVVLDK M+LF Sbjct: 292 FLNLNNKSPEYLSLFIDDKLKKGVKGMSEQEVEVVLDKAMVLF 334 Score = 47.0 bits (110), Expect(2) = 2e-14 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 175 FSYLHEKDVFERYYKQHLAKRLLSGKN 255 F +L EKDVFERYYKQHLAKRLL K+ Sbjct: 334 FRFLQEKDVFERYYKQHLAKRLLLNKS 360