BLASTX nr result
ID: Angelica23_contig00035208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035208 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADG96403.1| S-locus glycoprotein [Olea europaea] 57 2e-06 ref|XP_002274435.2| PREDICTED: G-type lectin S-receptor-like ser... 57 2e-06 ref|XP_002528870.1| conserved hypothetical protein [Ricinus comm... 55 4e-06 ref|XP_002529279.1| s-receptor kinase, putative [Ricinus communi... 55 6e-06 ref|XP_003597073.1| Kinase-like protein [Medicago truncatula] gi... 55 8e-06 >gb|ADG96403.1| S-locus glycoprotein [Olea europaea] Length = 413 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -2 Query: 85 TLVSKNGTFELGFFSPGDSKNYYVGIWY 2 TLVS GTFELGFFSPGDSKN YVGIWY Sbjct: 32 TLVSSGGTFELGFFSPGDSKNRYVGIWY 59 >ref|XP_002274435.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130-like [Vitis vinifera] Length = 808 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = -2 Query: 130 GMDXXXXXXXXXLNQTLVSKNGTFELGFFSPGDSKNYYVGIWY 2 G D NQT+ S GTFELGFF+PG+S+NYY+GIWY Sbjct: 24 GSDTIFPGQSLSGNQTIRSDGGTFELGFFTPGNSRNYYIGIWY 66 >ref|XP_002528870.1| conserved hypothetical protein [Ricinus communis] gi|223531669|gb|EEF33494.1| conserved hypothetical protein [Ricinus communis] Length = 465 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -2 Query: 127 MDXXXXXXXXXLNQTLVSKNGTFELGFFSPGDSKNYYVGIWY 2 MD +TLVS++GTFELGFFSPG +KN+Y+GIWY Sbjct: 1 MDTLTLNQSTDDGKTLVSQSGTFELGFFSPGSTKNHYLGIWY 42 >ref|XP_002529279.1| s-receptor kinase, putative [Ricinus communis] gi|223531268|gb|EEF33111.1| s-receptor kinase, putative [Ricinus communis] Length = 787 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = -2 Query: 136 SNGMDXXXXXXXXXLNQTLVSKNGTFELGFFSPGDSKNYYVGIWY 2 S+G D NQT+VS +G F +GFF PG+S+NYYVGIWY Sbjct: 25 SHGADRISAKQPLSGNQTIVSASGIFVMGFFRPGNSQNYYVGIWY 69 >ref|XP_003597073.1| Kinase-like protein [Medicago truncatula] gi|355486121|gb|AES67324.1| Kinase-like protein [Medicago truncatula] Length = 829 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -2 Query: 91 NQTLVSKNGTFELGFFSPGDSKNYYVGIWY 2 +QTL+S+ G FELGFF PG+S NYY+GIWY Sbjct: 39 DQTLISEGGIFELGFFKPGNSSNYYIGIWY 68