BLASTX nr result
ID: Angelica23_contig00035180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035180 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272401.1| PREDICTED: scarecrow-like protein 13 [Vitis ... 55 5e-06 >ref|XP_002272401.1| PREDICTED: scarecrow-like protein 13 [Vitis vinifera] Length = 545 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 103 MQTYQESQSSGAIHRLYHQPMQQVEPYCASRFQI 2 MQT +E QSSG IHRLYHQP+Q+++PYC S QI Sbjct: 1 MQTSEEHQSSGGIHRLYHQPVQELQPYCLSEIQI 34