BLASTX nr result
ID: Angelica23_contig00035038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00035038 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589011.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 74 1e-11 ref|XP_003588811.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 72 4e-11 ref|XP_003589008.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 70 2e-10 ref|XP_003588677.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 70 2e-10 ref|XP_003588839.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 69 3e-10 >ref|XP_003589011.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355478059|gb|AES59262.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 528 Score = 74.3 bits (181), Expect = 1e-11 Identities = 38/94 (40%), Positives = 58/94 (61%), Gaps = 5/94 (5%) Frame = -1 Query: 267 MAESSTRKVSRVKRDRISVLPRNILEIILCFMPLRDAVRTSVLSRSWRHCWTTIPNLDFD 88 MA T+ + DRIS LP ++++ I+ ++P+RDAVRTSVLSR+WR W T+PNL FD Sbjct: 1 MARKRTKSTLDAEPDRISWLPGHVIDQIMSYLPIRDAVRTSVLSRNWRKKWYTLPNLVFD 60 Query: 87 EYILKARLFTIETAF-----KFVSVINKVLLLHN 1 ++ T KF+ +++ VLL+H+ Sbjct: 61 TKLVPVPAATSGDPLAIIDNKFLQIVDHVLLVHS 94 >ref|XP_003588811.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355477859|gb|AES59062.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 449 Score = 72.4 bits (176), Expect = 4e-11 Identities = 36/93 (38%), Positives = 62/93 (66%), Gaps = 2/93 (2%) Frame = -1 Query: 273 KRMAESSTRKVSRVKRDRISVLPRNILEIILCFMPLRDAVRTSVLSRSWRHCWTTIPNLD 94 ++ ++S+ + + DRIS LP ++++ IL MP+++AVRTSVLS SWR+ W T+PNL Sbjct: 3 RKRSKSTHLTIKDAELDRISCLPGHVIDQILSLMPIKEAVRTSVLSSSWRNKWYTLPNLV 62 Query: 93 FDEYILK--ARLFTIETAFKFVSVINKVLLLHN 1 F+++ + A +T KF+ +++ VLL H+ Sbjct: 63 FNKHCISVAASKYTSVINNKFLRIVDHVLLQHS 95 >ref|XP_003589008.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355478056|gb|AES59259.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 433 Score = 70.1 bits (170), Expect = 2e-10 Identities = 39/93 (41%), Positives = 55/93 (59%), Gaps = 4/93 (4%) Frame = -1 Query: 267 MAESSTRKVSRVKRDRISVLPRNILEIILCFMPLRDAVRTSVLSRSWRHCWTTIPNLDFD 88 M T+ + DRIS LP ++ + I+ ++P+RDAVRTSVLSR+WR W T+PNL D Sbjct: 1 MERKRTKSTLDAEPDRISWLPGHVTDQIMSYLPIRDAVRTSVLSRNWRKKWYTLPNLVLD 60 Query: 87 EYILKARL----FTIETAFKFVSVINKVLLLHN 1 + A IE KF +++ VLLLH+ Sbjct: 61 RQCVSAEASQDPLVIEP--KFSKMVDHVLLLHS 91 >ref|XP_003588677.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355477725|gb|AES58928.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 657 Score = 70.1 bits (170), Expect = 2e-10 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 1/90 (1%) Frame = -1 Query: 270 RMAESSTRKVSRVKRDRISVLPRNILEIILCFMPLRDAVRTSVLSRSWRHCWTTIPNLDF 91 +++ESS + + DRISVLP ++++ IL +P+RD VRTS+LS WR+ W TIPNL F Sbjct: 308 KLSESSCLIMIDEEPDRISVLPGDVIDRILSCLPIRDVVRTSILSNKWRYKWITIPNLVF 367 Query: 90 DEYILKARL-FTIETAFKFVSVINKVLLLH 4 D + A K +++I+ VLLL+ Sbjct: 368 DSQCVSATSEHPAAIKRKLLAIIDHVLLLY 397 Score = 69.7 bits (169), Expect = 2e-10 Identities = 38/78 (48%), Positives = 53/78 (67%), Gaps = 3/78 (3%) Frame = -1 Query: 225 DRISVLPRNILEIILCFMPLRDAVRTSVLSRSWRHCWTTIPNLDFDEYILKA---RLFTI 55 DRIS LP ++++ IL +P+RD VRTSVL WR+ WTTIPNL FD+ + A R I Sbjct: 7 DRISCLPGDVIDRILLRLPIRDVVRTSVLCNKWRYKWTTIPNLVFDKQCVSATSHRPLVI 66 Query: 54 ETAFKFVSVINKVLLLHN 1 E K +++I+ VLLL++ Sbjct: 67 ER--KLLAIIDHVLLLYS 82 >ref|XP_003588839.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355477887|gb|AES59090.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 532 Score = 69.3 bits (168), Expect = 3e-10 Identities = 38/98 (38%), Positives = 61/98 (62%), Gaps = 7/98 (7%) Frame = -1 Query: 273 KRMAESSTRKVSRVKRDRISVLPRNILEIILCFMPLRDAVRTSVLSRSWRHCWTTIPNLD 94 +++A + R V V+ DRIS LP ++++ IL ++P+R+AV+TSVLS WR+ W T+PN+ Sbjct: 40 RKIANTIRRTVIGVEPDRISCLPGHVIDQILSYLPIREAVKTSVLSSEWRNKWHTLPNIV 99 Query: 93 FD-------EYILKARLFTIETAFKFVSVINKVLLLHN 1 FD E I +F K + +++ VLLLH+ Sbjct: 100 FDLNCVSNIEAIKDPSIF----MSKLLRIVDHVLLLHS 133