BLASTX nr result
ID: Angelica23_contig00034316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00034316 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32919.3| unnamed protein product [Vitis vinifera] 85 7e-15 ref|NP_001190724.1| F-box/LRR-repeat protein [Arabidopsis thalia... 75 6e-12 ref|NP_567422.1| F-box/LRR-repeat protein [Arabidopsis thaliana]... 75 6e-12 ref|NP_567414.1| putative F-box/LRR-repeat protein [Arabidopsis ... 74 2e-11 ref|NP_191479.1| F-box/LRR-repeat protein [Arabidopsis thaliana]... 73 2e-11 >emb|CBI32919.3| unnamed protein product [Vitis vinifera] Length = 411 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/69 (56%), Positives = 53/69 (76%) Frame = +3 Query: 3 PDPILTHILSFLPTKSAVGTTVLSKRWKSPFVSLPNLDFNDTVSIYRDIFGGDSRQKVSF 182 PD +L HI+SFLPTK AVGT+VLSKRW+ + S+PNLDF+D + + RD GDS + + F Sbjct: 16 PDAVLCHIISFLPTKFAVGTSVLSKRWRYLWASIPNLDFDDDLLLDRDKPIGDSERSICF 75 Query: 183 MNFVDRILM 209 NFVD++L+ Sbjct: 76 KNFVDKVLL 84 >ref|NP_001190724.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|332657973|gb|AEE83373.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 443 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/73 (50%), Positives = 51/73 (69%) Frame = +3 Query: 3 PDPILTHILSFLPTKSAVGTTVLSKRWKSPFVSLPNLDFNDTVSIYRDIFGGDSRQKVSF 182 PD I +HILSFLPTK A T+VLSK+W+ F +PNLD +D+V + + ++ SF Sbjct: 14 PDDISSHILSFLPTKEAASTSVLSKKWRYLFAFVPNLDLDDSVYLNPE---NETEISTSF 70 Query: 183 MNFVDRILMLRGN 221 M+FVDR+L L+GN Sbjct: 71 MDFVDRVLALQGN 83 >ref|NP_567422.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75245750|sp|Q8L7H1.1|FBL75_ARATH RecName: Full=F-box/LRR-repeat protein At4g14103 gi|22136642|gb|AAM91640.1| unknown protein [Arabidopsis thaliana] gi|332657972|gb|AEE83372.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 381 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/73 (50%), Positives = 51/73 (69%) Frame = +3 Query: 3 PDPILTHILSFLPTKSAVGTTVLSKRWKSPFVSLPNLDFNDTVSIYRDIFGGDSRQKVSF 182 PD I +HILSFLPTK A T+VLSK+W+ F +PNLD +D+V + + ++ SF Sbjct: 14 PDDISSHILSFLPTKEAASTSVLSKKWRYLFAFVPNLDLDDSVYLNPE---NETEISTSF 70 Query: 183 MNFVDRILMLRGN 221 M+FVDR+L L+GN Sbjct: 71 MDFVDRVLALQGN 83 >ref|NP_567414.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75318094|sp|O23257.1|FBL72_ARATH RecName: Full=Putative F-box/LRR-repeat protein At4g13960 gi|2244752|emb|CAB10175.1| hypothetical protein [Arabidopsis thaliana] gi|7268100|emb|CAB78438.1| hypothetical protein [Arabidopsis thaliana] gi|332657951|gb|AEE83351.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 434 Score = 73.6 bits (179), Expect = 2e-11 Identities = 38/75 (50%), Positives = 53/75 (70%), Gaps = 2/75 (2%) Frame = +3 Query: 3 PDPILTHILSFLPTKSAVGTTVLSKRWKSPFVSLPNLDFNDTVSIYRDIFGGDSRQKV-- 176 PD +L HILSFL TK A T++LSKRW++ F +PNLD +D+V ++ G + R ++ Sbjct: 8 PDEVLYHILSFLTTKEAALTSILSKRWRNLFTFVPNLDIDDSVFLHPQ-EGKEDRYEIQK 66 Query: 177 SFMNFVDRILMLRGN 221 SFM FVDR+L L+GN Sbjct: 67 SFMKFVDRVLALQGN 81 >ref|NP_191479.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264308|sp|Q9LX51.1|FBL64_ARATH RecName: Full=F-box/LRR-repeat protein At3g59200 gi|7801670|emb|CAB91590.1| putative protein [Arabidopsis thaliana] gi|26450835|dbj|BAC42525.1| unknown protein [Arabidopsis thaliana] gi|29028916|gb|AAO64837.1| At3g59200 [Arabidopsis thaliana] gi|332646367|gb|AEE79888.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 520 Score = 73.2 bits (178), Expect = 2e-11 Identities = 40/77 (51%), Positives = 53/77 (68%), Gaps = 4/77 (5%) Frame = +3 Query: 3 PDPILTHILSFLPTKSAVGTTVLSKRWKSPFVSLPNLDFNDTVSIYRDIFGGDSRQKV-- 176 P+P+++HILSFLPTK A T+VLSK+W+ F + NLDF+D S Y+D G + V Sbjct: 13 PNPVVSHILSFLPTKEAASTSVLSKKWRYLFAYVTNLDFDD--SDYQD---GKPKSDVEL 67 Query: 177 --SFMNFVDRILMLRGN 221 SFM FVDR+L L+GN Sbjct: 68 SRSFMEFVDRVLALQGN 84