BLASTX nr result
ID: Angelica23_contig00034010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00034010 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276643.1| PREDICTED: tubulin gamma-1 chain [Vitis vini... 122 4e-26 ref|XP_004133834.1| PREDICTED: tubulin gamma-2 chain-like [Cucum... 119 3e-25 gb|ABF19052.1| gamma-tubulin, partial [Nicotiana tabacum] 118 4e-25 emb|CAC00547.1| gamma tubulin [Nicotiana tabacum] 118 4e-25 ref|XP_002320847.1| tubulin gamma-1 chain, at3g61650-like protei... 115 5e-24 >ref|XP_002276643.1| PREDICTED: tubulin gamma-1 chain [Vitis vinifera] gi|297745396|emb|CBI40476.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 122 bits (305), Expect = 4e-26 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 389 PLFDDNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGSVDPSLA 210 P+F DNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNA+G+VDP LA Sbjct: 414 PMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNASGAVDPKLA 473 Query: 209 I 207 + Sbjct: 474 V 474 >ref|XP_004133834.1| PREDICTED: tubulin gamma-2 chain-like [Cucumis sativus] gi|449480269|ref|XP_004155846.1| PREDICTED: tubulin gamma-2 chain-like [Cucumis sativus] Length = 474 Score = 119 bits (297), Expect = 3e-25 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -3 Query: 389 PLFDDNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGSVDPSLA 210 P+F DNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPD ILTGEGNA+G+ DPSLA Sbjct: 414 PMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDQILTGEGNASGTADPSLA 473 Query: 209 I 207 + Sbjct: 474 V 474 >gb|ABF19052.1| gamma-tubulin, partial [Nicotiana tabacum] Length = 464 Score = 118 bits (296), Expect = 4e-25 Identities = 52/61 (85%), Positives = 58/61 (95%) Frame = -3 Query: 389 PLFDDNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGSVDPSLA 210 P F DNDLSEFDESRD+IESLVDEYKACESPDYIKWGMEDPDH+LTGEGNA+G+VDP L+ Sbjct: 404 PTFADNDLSEFDESRDVIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNASGTVDPKLS 463 Query: 209 I 207 + Sbjct: 464 L 464 >emb|CAC00547.1| gamma tubulin [Nicotiana tabacum] Length = 474 Score = 118 bits (296), Expect = 4e-25 Identities = 52/61 (85%), Positives = 58/61 (95%) Frame = -3 Query: 389 PLFDDNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGSVDPSLA 210 P F DNDLSEFDESRD+IESLVDEYKACESPDYIKWGMEDPDH+LTGEGNA+G+VDP L+ Sbjct: 414 PTFADNDLSEFDESRDVIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNASGTVDPKLS 473 Query: 209 I 207 + Sbjct: 474 L 474 >ref|XP_002320847.1| tubulin gamma-1 chain, at3g61650-like protein [Populus trichocarpa] gi|222861620|gb|EEE99162.1| tubulin gamma-1 chain, at3g61650-like protein [Populus trichocarpa] Length = 474 Score = 115 bits (287), Expect = 5e-24 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = -3 Query: 389 PLFDDNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGSVDPSLA 210 P+F DNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPD++LT EGNA G+VDP LA Sbjct: 414 PMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDNLLTEEGNAKGTVDPKLA 473 Query: 209 I 207 I Sbjct: 474 I 474