BLASTX nr result
ID: Angelica23_contig00033123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00033123 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002882939.1| hypothetical protein ARALYDRAFT_478976 [Arab... 69 3e-10 ref|NP_566511.1| Plasma-membrane choline transporter family prot... 69 4e-10 gb|AAF35404.1| hypothetical protein [Arabidopsis thaliana] 69 4e-10 dbj|BAB02367.1| unnamed protein product [Arabidopsis thaliana] 69 4e-10 ref|XP_004173528.1| PREDICTED: CTL-like protein 1-like, partial ... 67 2e-09 >ref|XP_002882939.1| hypothetical protein ARALYDRAFT_478976 [Arabidopsis lyrata subsp. lyrata] gi|297328779|gb|EFH59198.1| hypothetical protein ARALYDRAFT_478976 [Arabidopsis lyrata subsp. lyrata] Length = 697 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/49 (67%), Positives = 40/49 (81%), Gaps = 3/49 (6%) Frame = +1 Query: 193 GPLGAVAG---STEMGSNNNGIIKHNRKCKDVVFLVFFIAFWVAMIVNS 330 GPLGAV G S++ + N+GIIKHNRKC+D+ FLV FIAFWV+MIVNS Sbjct: 3 GPLGAVIGRYTSSDGSAPNDGIIKHNRKCRDITFLVIFIAFWVSMIVNS 51 >ref|NP_566511.1| Plasma-membrane choline transporter family protein [Arabidopsis thaliana] gi|15028189|gb|AAK76591.1| unknown protein [Arabidopsis thaliana] gi|25055020|gb|AAN71973.1| unknown protein [Arabidopsis thaliana] gi|332642140|gb|AEE75661.1| Plasma-membrane choline transporter family protein [Arabidopsis thaliana] Length = 700 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/49 (65%), Positives = 40/49 (81%), Gaps = 3/49 (6%) Frame = +1 Query: 193 GPLGAVAG---STEMGSNNNGIIKHNRKCKDVVFLVFFIAFWVAMIVNS 330 GPLGAV G S++ + N+GIIKHNRKC+D+ FL+ FIAFWV+MIVNS Sbjct: 3 GPLGAVIGRYTSSDGSAPNDGIIKHNRKCRDITFLIIFIAFWVSMIVNS 51 >gb|AAF35404.1| hypothetical protein [Arabidopsis thaliana] Length = 722 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/49 (65%), Positives = 40/49 (81%), Gaps = 3/49 (6%) Frame = +1 Query: 193 GPLGAVAG---STEMGSNNNGIIKHNRKCKDVVFLVFFIAFWVAMIVNS 330 GPLGAV G S++ + N+GIIKHNRKC+D+ FL+ FIAFWV+MIVNS Sbjct: 3 GPLGAVIGRYTSSDGSAPNDGIIKHNRKCRDITFLIIFIAFWVSMIVNS 51 >dbj|BAB02367.1| unnamed protein product [Arabidopsis thaliana] Length = 697 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/49 (65%), Positives = 40/49 (81%), Gaps = 3/49 (6%) Frame = +1 Query: 193 GPLGAVAG---STEMGSNNNGIIKHNRKCKDVVFLVFFIAFWVAMIVNS 330 GPLGAV G S++ + N+GIIKHNRKC+D+ FL+ FIAFWV+MIVNS Sbjct: 3 GPLGAVIGRYTSSDGSAPNDGIIKHNRKCRDITFLIIFIAFWVSMIVNS 51 >ref|XP_004173528.1| PREDICTED: CTL-like protein 1-like, partial [Cucumis sativus] Length = 347 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/49 (65%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = +1 Query: 193 GPLGAVAG---STEMGSNNNGIIKHNRKCKDVVFLVFFIAFWVAMIVNS 330 GPLGAV G S++ + GII+HNRKC+D+VFLV FIAFWV MIVNS Sbjct: 3 GPLGAVIGRYPSSDGNAQMGGIIRHNRKCRDIVFLVIFIAFWVGMIVNS 51