BLASTX nr result
ID: Angelica23_contig00032934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00032934 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530948.1| catalytic, putative [Ricinus communis] gi|22... 55 8e-06 >ref|XP_002530948.1| catalytic, putative [Ricinus communis] gi|223529463|gb|EEF31420.1| catalytic, putative [Ricinus communis] Length = 512 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -2 Query: 129 MGDKNAPHIGLLSQKSMFCLFTFVSILFIFSWLFVLRYTGRPN 1 M +K++ + ++S+KS+F LF+FV +LFI SW FVLR TGRPN Sbjct: 1 MAEKHSSSLVVISRKSLFGLFSFVLVLFILSWFFVLRSTGRPN 43