BLASTX nr result
ID: Angelica23_contig00032726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00032726 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containi... 55 4e-06 emb|CBI26569.3| unnamed protein product [Vitis vinifera] 55 4e-06 emb|CAN76113.1| hypothetical protein VITISV_005528 [Vitis vinifera] 55 6e-06 >ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Vitis vinifera] Length = 494 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -3 Query: 194 QVPLIYKEMESVGCTPDRKARELLQTALMVIEK 96 +VP IY+EMES GCTPDRKARE+LQTAL+V+++ Sbjct: 426 KVPEIYEEMESAGCTPDRKAREMLQTALLVLQQ 458 >emb|CBI26569.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -3 Query: 194 QVPLIYKEMESVGCTPDRKARELLQTALMVIEK 96 +VP IY+EMES GCTPDRKARE+LQTAL+V+++ Sbjct: 347 KVPEIYEEMESAGCTPDRKAREMLQTALLVLQQ 379 >emb|CAN76113.1| hypothetical protein VITISV_005528 [Vitis vinifera] Length = 466 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 191 VPLIYKEMESVGCTPDRKARELLQTALMVIEK 96 VP IY+EMES GCTPDRKARE+LQTAL+V+++ Sbjct: 422 VPEIYEEMESAGCTPDRKAREMLQTALLVLQQ 453