BLASTX nr result
ID: Angelica23_contig00032584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00032584 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002863658.1| hypothetical protein ARALYDRAFT_917317 [Arab... 59 3e-07 ref|NP_199153.1| uncharacterized protein [Arabidopsis thaliana] ... 58 9e-07 ref|XP_002863659.1| hypothetical protein ARALYDRAFT_494659 [Arab... 57 2e-06 gb|AAZ52775.1| hypothetical protein At5g43390 [Arabidopsis thali... 56 3e-06 ref|NP_199152.1| uncharacterized protein [Arabidopsis thaliana] ... 56 3e-06 >ref|XP_002863658.1| hypothetical protein ARALYDRAFT_917317 [Arabidopsis lyrata subsp. lyrata] gi|297309493|gb|EFH39917.1| hypothetical protein ARALYDRAFT_917317 [Arabidopsis lyrata subsp. lyrata] Length = 657 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +3 Query: 168 EVRIERNKANVIEDKENAPQLHLIKGSTLLEKSKFIREMKWNMNTNFQRVFDK 326 E+ E K VI EN PQLH++ G++L EK++F+REM W MNT+FQ+VFD+ Sbjct: 462 ELNEEPWKGKVITFSEN-PQLHIVTGASLREKTEFVREMDWGMNTDFQKVFDR 513 >ref|NP_199153.1| uncharacterized protein [Arabidopsis thaliana] gi|8843893|dbj|BAA97419.1| unnamed protein product [Arabidopsis thaliana] gi|18450363|gb|AAK82505.2| AT5g43400/MWF20_9 [Arabidopsis thaliana] gi|25090369|gb|AAN72286.1| At5g43400/MWF20_9 [Arabidopsis thaliana] gi|332007573|gb|AED94956.1| uncharacterized protein [Arabidopsis thaliana] Length = 655 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +3 Query: 168 EVRIERNKANVIEDKENAPQLHLIKGSTLLEKSKFIREMKWNMNTNFQRVFDK 326 E+ E K VI EN P+LH++ GS+L EK++F+REM+W MNT+FQ VFD+ Sbjct: 460 ELSEEPWKGKVITFSEN-PELHIVTGSSLREKTQFVREMEWGMNTDFQIVFDR 511 >ref|XP_002863659.1| hypothetical protein ARALYDRAFT_494659 [Arabidopsis lyrata subsp. lyrata] gi|297309494|gb|EFH39918.1| hypothetical protein ARALYDRAFT_494659 [Arabidopsis lyrata subsp. lyrata] Length = 648 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = +3 Query: 168 EVRIERNKANVIEDKENAPQLHLIKGSTLLEKSKFIREMKWNMNTNFQRVFDK 326 E+ E K VI EN PQLH++ GS+L EK+ F+R M W MNT+FQ+VFD+ Sbjct: 452 ELNEEPWKGKVITFSEN-PQLHVVTGSSLREKTGFVRAMDWGMNTDFQKVFDR 503 >gb|AAZ52775.1| hypothetical protein At5g43390 [Arabidopsis thaliana] Length = 356 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +3 Query: 168 EVRIERNKANVIEDKENAPQLHLIKGSTLLEKSKFIREMKWNMNTNFQRVFDK 326 E+ E K VI EN PQLH++ GS+L EK+KF+REM + +NT+FQ+VFD+ Sbjct: 161 ELNEEPWKGKVITFSEN-PQLHVVTGSSLREKTKFVREMDFGINTDFQKVFDR 212 >ref|NP_199152.1| uncharacterized protein [Arabidopsis thaliana] gi|8843892|dbj|BAA97418.1| unnamed protein product [Arabidopsis thaliana] gi|71905593|gb|AAZ52774.1| hypothetical protein At5g43390 [Arabidopsis thaliana] gi|91805687|gb|ABE65572.1| hypothetical protein At5g43390 [Arabidopsis thaliana] gi|332007572|gb|AED94955.1| uncharacterized protein [Arabidopsis thaliana] Length = 643 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +3 Query: 168 EVRIERNKANVIEDKENAPQLHLIKGSTLLEKSKFIREMKWNMNTNFQRVFDK 326 E+ E K VI EN PQLH++ GS+L EK+KF+REM + +NT+FQ+VFD+ Sbjct: 448 ELNEEPWKGKVITFSEN-PQLHVVTGSSLREKTKFVREMDFGINTDFQKVFDR 499