BLASTX nr result
ID: Angelica23_contig00032450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00032450 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_740149.1| RNA polymerase alpha subunit [Daucus carota] gi... 72 4e-11 ref|YP_086997.1| RNA polymerase alpha subunit [Panax ginseng] gi... 71 1e-10 ref|YP_004935584.1| RNA polymerase alpha subunit (chloroplast) [... 69 4e-10 gb|ABU85224.1| RNA polymerase alpha subunit [Anethum graveolens] 55 6e-06 >ref|YP_740149.1| RNA polymerase alpha subunit [Daucus carota] gi|122239960|sp|Q0G9T0.1|RPOA_DAUCA RecName: Full=DNA-directed RNA polymerase subunit alpha; Short=PEP; AltName: Full=Plastid-encoded RNA polymerase subunit alpha; Short=RNA polymerase subunit alpha gi|113200939|gb|ABI32455.1| RNA polymerase alpha subunit [Daucus carota] Length = 353 Score = 72.4 bits (176), Expect = 4e-11 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +1 Query: 1 EHFRINDVKQILGILKKHFSIDLPKKSKMGFESLAQLIDSESG 129 EHFRI DVKQILGIL+K+FSI+L KK KMGFESLAQLIDS+SG Sbjct: 311 EHFRIKDVKQILGILEKNFSINLGKKPKMGFESLAQLIDSKSG 353 >ref|YP_086997.1| RNA polymerase alpha subunit [Panax ginseng] gi|68053096|sp|Q68RX5.1|RPOA_PANGI RecName: Full=DNA-directed RNA polymerase subunit alpha; Short=PEP; AltName: Full=Plastid-encoded RNA polymerase subunit alpha; Short=RNA polymerase subunit alpha gi|51235344|gb|AAT98540.1| RNA polymerase alpha subunit [Panax ginseng] Length = 353 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = +1 Query: 1 EHFRINDVKQILGILKKHFSIDLPKKSKMGFESLAQLIDSESG 129 EHFRI DVK ILGIL+KHF+IDLPKK K+GFESLAQ I SESG Sbjct: 311 EHFRIEDVKAILGILEKHFAIDLPKKLKIGFESLAQSIYSESG 353 >ref|YP_004935584.1| RNA polymerase alpha subunit (chloroplast) [Eleutherococcus senticosus] gi|347448239|gb|AEO92651.1| RNA polymerase alpha subunit (chloroplast) [Eleutherococcus senticosus] Length = 353 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +1 Query: 1 EHFRINDVKQILGILKKHFSIDLPKKSKMGFESLAQLIDSESG 129 EHFRI DVK+ILGIL+K F+IDLPKK K+GFESLAQ I SESG Sbjct: 311 EHFRIEDVKEILGILEKRFAIDLPKKLKIGFESLAQSIYSESG 353 >gb|ABU85224.1| RNA polymerase alpha subunit [Anethum graveolens] Length = 338 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 1 EHFRINDVKQILGILKKHFSIDLPKK 78 EHFRINDVKQILGIL+KHFSIDLPKK Sbjct: 313 EHFRINDVKQILGILEKHFSIDLPKK 338