BLASTX nr result
ID: Angelica23_contig00032272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00032272 (525 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBA31922.1| hypothetical protein Csp_D29540 [Curvibacter put... 94 2e-17 ref|ZP_05718698.1| hypothetical protein VMD_37440 [Vibrio mimicu... 90 2e-16 ref|ZP_04529120.1| conserved hypothetical protein [Clostridium b... 51 4e-15 ref|ZP_04526499.1| conserved hypothetical protein [Clostridium b... 51 4e-15 ref|ZP_04526295.1| conserved hypothetical protein [Clostridium b... 51 4e-15 >emb|CBA31922.1| hypothetical protein Csp_D29540 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 156 Score = 93.6 bits (231), Expect = 2e-17 Identities = 48/74 (64%), Positives = 49/74 (66%) Frame = -2 Query: 506 PHQLTFQHRAGVTPYTSTFVFAECCVFNKQLQRPGICDCQ*LCSA*LLTIGSVPSPEVTV 327 PH L FQHRAGVTPYTSTFVFAECCVFNKQ Q P C+ L PS EVTV Sbjct: 83 PHHLIFQHRAGVTPYTSTFVFAECCVFNKQSQPPIFCNLIGLHPRGTSPTKGTPSSEVTV 142 Query: 326 PFCLVPSAEFSQAP 285 C VPS EFSQAP Sbjct: 143 SICRVPSPEFSQAP 156 >ref|ZP_05718698.1| hypothetical protein VMD_37440 [Vibrio mimicus VM573] gi|258583990|gb|EEW08769.1| hypothetical protein VMD_37440 [Vibrio mimicus VM573] Length = 104 Score = 90.1 bits (222), Expect = 2e-16 Identities = 47/63 (74%), Positives = 50/63 (79%) Frame = -1 Query: 363 HHRQRTFSRSYGTILPSSFSRVLSSALVFST*PPVSV*GTICL*LSLRSFSWKQGICHFA 184 HH++RTFSRSYGTILPSSF+RVLSSALVFST PPVSV GTI L LR FSWK GI F Sbjct: 28 HHQERTFSRSYGTILPSSFTRVLSSALVFSTRPPVSVWGTIPYNLKLRGFSWKHGINDFT 87 Query: 183 VQV 175 V Sbjct: 88 TVV 90 >ref|ZP_04529120.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237657484|gb|EEP55040.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] Length = 162 Score = 51.2 bits (121), Expect(3) = 4e-15 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -2 Query: 497 LTFQHRAGVTPYTSTFVFAECCVFNKQLQRPGIC 396 LTFQHRAGV+PYTS + AE CVF KQL P +C Sbjct: 4 LTFQHRAGVSPYTSAYALAETCVFVKQLLVPILC 37 Score = 47.8 bits (112), Expect(3) = 4e-15 Identities = 31/53 (58%), Positives = 34/53 (64%) Frame = -1 Query: 345 FSRSYGTILPSSFSRVLSSALVFST*PPVSV*GTICL*LSLRSFSWKQGICHF 187 FSRSYG LPSS + +L SAL FS PVSV GT LS R FSWK I +F Sbjct: 46 FSRSYGVNLPSSLTVILPSALGFSPHLPVSVCGTGTTSLS-RCFSWKHEIRYF 97 Score = 26.9 bits (58), Expect(3) = 4e-15 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -3 Query: 82 ITFSVPPSHHK--QVSEY*PISHRLRLSA 2 ++FSV PS V EY PI HRLRLSA Sbjct: 132 LSFSVTPSIITIIVVLEYQPIVHRLRLSA 160 >ref|ZP_04526499.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237669625|ref|ZP_04529603.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237654859|gb|EEP52421.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237657713|gb|EEP55268.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] Length = 162 Score = 51.2 bits (121), Expect(3) = 4e-15 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -2 Query: 497 LTFQHRAGVTPYTSTFVFAECCVFNKQLQRPGIC 396 LTFQHRAGV+PYTS + AE CVF KQL P +C Sbjct: 4 LTFQHRAGVSPYTSAYALAETCVFVKQLLVPILC 37 Score = 47.8 bits (112), Expect(3) = 4e-15 Identities = 31/53 (58%), Positives = 34/53 (64%) Frame = -1 Query: 345 FSRSYGTILPSSFSRVLSSALVFST*PPVSV*GTICL*LSLRSFSWKQGICHF 187 FSRSYG LPSS + +L SAL FS PVSV GT LS R FSWK I +F Sbjct: 46 FSRSYGVNLPSSLTVILPSALGFSPHLPVSVCGTGTTSLS-RCFSWKHEIRYF 97 Score = 26.9 bits (58), Expect(3) = 4e-15 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -3 Query: 82 ITFSVPPSHHK--QVSEY*PISHRLRLSA 2 ++FSV PS V EY PI HRLRLSA Sbjct: 132 LSFSVTPSIITIIVVLEYQPIVHRLRLSA 160 >ref|ZP_04526295.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237666770|ref|ZP_04526755.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237669455|ref|ZP_04529436.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237669591|ref|ZP_04529570.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237669632|ref|ZP_04529610.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237669746|ref|ZP_04529723.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237654820|gb|EEP52383.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237654866|gb|EEP52428.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237654907|gb|EEP52468.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237655038|gb|EEP52597.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237657969|gb|EEP55524.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237658190|gb|EEP55744.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] Length = 162 Score = 51.2 bits (121), Expect(3) = 4e-15 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -2 Query: 497 LTFQHRAGVTPYTSTFVFAECCVFNKQLQRPGIC 396 LTFQHRAGV+PYTS + AE CVF KQL P +C Sbjct: 4 LTFQHRAGVSPYTSAYALAETCVFVKQLLVPILC 37 Score = 47.8 bits (112), Expect(3) = 4e-15 Identities = 31/53 (58%), Positives = 34/53 (64%) Frame = -1 Query: 345 FSRSYGTILPSSFSRVLSSALVFST*PPVSV*GTICL*LSLRSFSWKQGICHF 187 FSRSYG LPSS + +L SAL FS PVSV GT LS R FSWK I +F Sbjct: 46 FSRSYGVNLPSSLTVILPSALGFSPHLPVSVCGTGTTSLS-RCFSWKHEIRYF 97 Score = 26.9 bits (58), Expect(3) = 4e-15 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -3 Query: 82 ITFSVPPSHHK--QVSEY*PISHRLRLSA 2 ++FSV PS V EY PI HRLRLSA Sbjct: 132 LSFSVTPSIITIIVVLEYQPIVHRLRLSA 160