BLASTX nr result
ID: Angelica23_contig00032205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00032205 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530585.1| nascent polypeptide associated complex alpha... 61 8e-08 >ref|XP_002530585.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] gi|223529884|gb|EEF31815.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] Length = 687 Score = 61.2 bits (147), Expect = 8e-08 Identities = 33/113 (29%), Positives = 58/113 (51%) Frame = -1 Query: 399 YLGERCRRQLGLSCLVPHKPPEKMHEEQSKVEQKSKDKHDDHINTGRSAETLVRNDIADY 220 Y+GER RQ G +PH PP + + E S++ + K + G A L+ + Y Sbjct: 523 YMGERNLRQFGGGVRIPHSPPAERYGEGSQILTGAARK----LLQGVDAWDLLEDKEYSY 578 Query: 219 AAWFANNSIGKIVDVTQLIGGPDIGRKVLSHWMAKHRPNMILVPKSEVKEITE 61 WF NS+G+IVD+ Q G +G ++L W+ H+ ++ +++E+ + Sbjct: 579 VEWFRANSLGRIVDLDQFQGRKILGGRLLELWLRVHQDGHKVISPQDLQELED 631