BLASTX nr result
ID: Angelica23_contig00032188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00032188 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605939.1| hypothetical protein MTR_4g049300 [Medicago ... 56 3e-06 >ref|XP_003605939.1| hypothetical protein MTR_4g049300 [Medicago truncatula] gi|358344153|ref|XP_003636156.1| hypothetical protein MTR_032s0004 [Medicago truncatula] gi|355502091|gb|AES83294.1| hypothetical protein MTR_032s0004 [Medicago truncatula] gi|355506994|gb|AES88136.1| hypothetical protein MTR_4g049300 [Medicago truncatula] Length = 133 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/83 (32%), Positives = 45/83 (54%) Frame = -2 Query: 259 IVQTVNWNDLGQPIGKESIKLAFFIGNYARRNIPITCDDWRKKEWLTVKQTLCDEIKETF 80 +++ V WN GQP+GKES ++G R +PI+ ++WR + K+ + DEI++ + Sbjct: 3 LIRFVRWNARGQPVGKESEGFVSYVGVIVCRMVPISIENWRAPKMKPYKENVLDEIRKDY 62 Query: 79 HGISDEHMKKIISRAGELQRQFR 11 DEH + AG L F+ Sbjct: 63 I-FGDEHENHVKMEAGRLFTTFK 84