BLASTX nr result
ID: Angelica23_contig00031484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00031484 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553987.1| PREDICTED: calcium-binding mitochondrial car... 56 4e-06 emb|CBI15774.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|XP_002284731.1| PREDICTED: calcium-binding mitochondrial car... 55 6e-06 emb|CAN83157.1| hypothetical protein VITISV_022552 [Vitis vinifera] 55 6e-06 >ref|XP_003553987.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Glycine max] Length = 477 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +1 Query: 364 SATPPLDRLKLVLQVQTNLASTLPVVKSIWNEGALLPFF*GTSTSL 501 +AT PLDRLK+VLQVQT A +P +K IW EG LL FF G ++ Sbjct: 213 TATAPLDRLKVVLQVQTTRAQIMPAIKDIWKEGGLLGFFRGNGLNV 258 >emb|CBI15774.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +1 Query: 364 SATPPLDRLKLVLQVQTNLASTLPVVKSIWNEGALLPFF*GTSTSL 501 +AT PLDRLK+VLQVQT A +P +K+IW EG LL FF G ++ Sbjct: 281 TATAPLDRLKVVLQVQTTHARIVPAIKNIWKEGGLLGFFRGNGLNV 326 >ref|XP_002284731.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Vitis vinifera] Length = 511 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +1 Query: 364 SATPPLDRLKLVLQVQTNLASTLPVVKSIWNEGALLPFF*GTSTSL 501 +AT PLDRLK+VLQVQT A +P +K+IW EG LL FF G ++ Sbjct: 244 TATAPLDRLKVVLQVQTTHARIVPAIKNIWKEGGLLGFFRGNGLNV 289 >emb|CAN83157.1| hypothetical protein VITISV_022552 [Vitis vinifera] Length = 496 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +1 Query: 364 SATPPLDRLKLVLQVQTNLASTLPVVKSIWNEGALLPFF*GTSTSL 501 +AT PLDRLK+VLQVQT A +P +K+IW EG LL FF G ++ Sbjct: 229 TATAPLDRLKVVLQVQTTHARIVPAIKNIWKEGGLLGFFRGNGLNV 274