BLASTX nr result
ID: Angelica23_contig00031352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00031352 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002882593.1| electron transport SCO1/SenC family protein ... 64 2e-08 gb|AAF07830.1|AC010871_6 putative SCO1 protein [Arabidopsis thal... 64 2e-08 ref|NP_566339.1| electron transport SCO1/SenC-like protein [Arab... 64 2e-08 ref|XP_002532105.1| Protein sco1, putative [Ricinus communis] gi... 61 1e-07 gb|ABK24183.1| unknown [Picea sitchensis] 60 1e-07 >ref|XP_002882593.1| electron transport SCO1/SenC family protein [Arabidopsis lyrata subsp. lyrata] gi|297328433|gb|EFH58852.1| electron transport SCO1/SenC family protein [Arabidopsis lyrata subsp. lyrata] Length = 334 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 226 LMDPNMQFVKFYGKNHDVDSLTDGVIQEIKQYKK 125 LM P M FVKFYGKNHDVDSLTDGV++EI+QY+K Sbjct: 301 LMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 334 >gb|AAF07830.1|AC010871_6 putative SCO1 protein [Arabidopsis thaliana] Length = 273 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 226 LMDPNMQFVKFYGKNHDVDSLTDGVIQEIKQYKK 125 LM P M FVKFYGKNHDVDSLTDGV++EI+QY+K Sbjct: 240 LMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 273 >ref|NP_566339.1| electron transport SCO1/SenC-like protein [Arabidopsis thaliana] gi|75161513|sp|Q8VYP0.1|SCO11_ARATH RecName: Full=Protein SCO1 homolog 1, mitochondrial; AltName: Full=Homolog of the copper chaperone SCO1 member 1; Short=HCC1; Flags: Precursor gi|17979327|gb|AAL49889.1| putative SCO1 protein [Arabidopsis thaliana] gi|20465763|gb|AAM20370.1| putative SCO1 protein [Arabidopsis thaliana] gi|21553398|gb|AAM62491.1| putative SCO1 protein [Arabidopsis thaliana] gi|332641180|gb|AEE74701.1| electron transport SCO1/SenC-like protein [Arabidopsis thaliana] Length = 334 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 226 LMDPNMQFVKFYGKNHDVDSLTDGVIQEIKQYKK 125 LM P M FVKFYGKNHDVDSLTDGV++EI+QY+K Sbjct: 301 LMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 334 >ref|XP_002532105.1| Protein sco1, putative [Ricinus communis] gi|223528208|gb|EEF30267.1| Protein sco1, putative [Ricinus communis] Length = 292 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 226 LMDPNMQFVKFYGKNHDVDSLTDGVIQEIKQYK 128 LM PNM +VKF+GKN+DVDSLTDGVI+EIKQYK Sbjct: 257 LMGPNMDYVKFFGKNNDVDSLTDGVIKEIKQYK 289 >gb|ABK24183.1| unknown [Picea sitchensis] Length = 331 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 226 LMDPNMQFVKFYGKNHDVDSLTDGVIQEIKQYKK 125 LMDP+M+FVKF+GKN+DVD+LT+GVI E+K YKK Sbjct: 298 LMDPDMEFVKFFGKNYDVDALTEGVINEVKSYKK 331