BLASTX nr result
ID: Angelica23_contig00031143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00031143 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321745.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002280796.1| PREDICTED: serine carboxypeptidase-like 45-l... 59 3e-07 emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinife... 59 3e-07 gb|AAG51475.1|AC069471_6 serine carboxypeptidase II, putative [A... 59 5e-07 ref|XP_002893504.1| SCPL45 [Arabidopsis lyrata subsp. lyrata] gi... 59 5e-07 >ref|XP_002321745.1| predicted protein [Populus trichocarpa] gi|222868741|gb|EEF05872.1| predicted protein [Populus trichocarpa] Length = 436 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 102 KITQLPGQPQVGFQQFSGYVTVDNNKKERALFYY 1 KI +LPGQP VGFQQFSGYVTVDNN K RALFYY Sbjct: 2 KIARLPGQPHVGFQQFSGYVTVDNN-KHRALFYY 34 >ref|XP_002280796.1| PREDICTED: serine carboxypeptidase-like 45-like [Vitis vinifera] Length = 452 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 102 KITQLPGQPQVGFQQFSGYVTVDNNKKERALFYY 1 KI QLPGQPQVGFQQFSGYV++D +KK+RALFYY Sbjct: 23 KIIQLPGQPQVGFQQFSGYVSLD-DKKQRALFYY 55 >emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinifera] gi|297734496|emb|CBI15743.3| unnamed protein product [Vitis vinifera] Length = 462 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 102 KITQLPGQPQVGFQQFSGYVTVDNNKKERALFYY 1 KI QLPGQPQVGFQQFSGYV++D +KK+RALFYY Sbjct: 33 KIIQLPGQPQVGFQQFSGYVSLD-DKKQRALFYY 65 >gb|AAG51475.1|AC069471_6 serine carboxypeptidase II, putative [Arabidopsis thaliana] Length = 456 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 102 KITQLPGQPQVGFQQFSGYVTVDNNKKERALFYY 1 ++T+LPGQP+VGFQQ+SGYVTVD +KK+RALFYY Sbjct: 31 RVTRLPGQPRVGFQQYSGYVTVD-DKKQRALFYY 63 >ref|XP_002893504.1| SCPL45 [Arabidopsis lyrata subsp. lyrata] gi|297339346|gb|EFH69763.1| SCPL45 [Arabidopsis lyrata subsp. lyrata] Length = 462 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 102 KITQLPGQPQVGFQQFSGYVTVDNNKKERALFYY 1 ++T+LPGQP+VGFQQ+SGYVTVD +KK+RALFYY Sbjct: 32 RVTRLPGQPRVGFQQYSGYVTVD-DKKQRALFYY 64