BLASTX nr result
ID: Angelica23_contig00030768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030768 (501 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83206.1| hypothetical protein VITISV_019937 [Vitis vinifera] 81 1e-13 ref|XP_002520562.1| ubiquitin specific protease 39 and snrnp ass... 80 2e-13 ref|XP_002308779.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 ref|XP_002322534.1| predicted protein [Populus trichocarpa] gi|2... 79 4e-13 ref|XP_003541464.1| PREDICTED: U4/U6.U5 tri-snRNP-associated pro... 78 8e-13 >emb|CAN83206.1| hypothetical protein VITISV_019937 [Vitis vinifera] Length = 566 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 500 FVQRKSEELWYEMQDLHVSETLPQMVALSETYVQIYEQQ 384 FVQRKSEELWYEMQDLHVSETLPQMVALSETY+QIYEQQ Sbjct: 527 FVQRKSEELWYEMQDLHVSETLPQMVALSETYMQIYEQQ 565 >ref|XP_002520562.1| ubiquitin specific protease 39 and snrnp assembly factor, putative [Ricinus communis] gi|223540222|gb|EEF41795.1| ubiquitin specific protease 39 and snrnp assembly factor, putative [Ricinus communis] Length = 557 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 500 FVQRKSEELWYEMQDLHVSETLPQMVALSETYVQIYEQQ 384 FVQRKSEELWYEMQDLHVSETLPQMVALSE YVQIYEQQ Sbjct: 518 FVQRKSEELWYEMQDLHVSETLPQMVALSEAYVQIYEQQ 556 >ref|XP_002308779.1| predicted protein [Populus trichocarpa] gi|222854755|gb|EEE92302.1| predicted protein [Populus trichocarpa] Length = 557 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 500 FVQRKSEELWYEMQDLHVSETLPQMVALSETYVQIYEQQ 384 FVQRKSEELWYEMQDLHVSETLPQMVALSE YVQIYEQQ Sbjct: 518 FVQRKSEELWYEMQDLHVSETLPQMVALSEAYVQIYEQQ 556 >ref|XP_002322534.1| predicted protein [Populus trichocarpa] gi|222867164|gb|EEF04295.1| predicted protein [Populus trichocarpa] Length = 530 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 500 FVQRKSEELWYEMQDLHVSETLPQMVALSETYVQIYEQQ 384 FVQRKSEELWYEMQDLHVSETLPQMVALSE Y+QIYEQQ Sbjct: 491 FVQRKSEELWYEMQDLHVSETLPQMVALSEAYLQIYEQQ 529 >ref|XP_003541464.1| PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like [Glycine max] Length = 563 Score = 77.8 bits (190), Expect = 8e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 500 FVQRKSEELWYEMQDLHVSETLPQMVALSETYVQIYEQQ 384 FVQRKSEELWYEMQDLHVSETLP +VALSETY+QIYEQQ Sbjct: 524 FVQRKSEELWYEMQDLHVSETLPHLVALSETYMQIYEQQ 562