BLASTX nr result
ID: Angelica23_contig00030753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030753 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274224.2| PREDICTED: pentatricopeptide repeat-containi... 106 2e-21 ref|XP_002521729.1| pentatricopeptide repeat-containing protein,... 97 2e-18 ref|XP_002307219.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 ref|XP_003516519.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|XP_003612374.1| Pentatricopeptide repeat-containing protein ... 82 5e-14 >ref|XP_002274224.2| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Vitis vinifera] Length = 686 Score = 106 bits (264), Expect = 2e-21 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = +3 Query: 183 LTFHSKPISSSPVPSHQHIAHLILDQKSPSQAIQTFKWASKLPHFTHTQSTYRALVHKLC 362 + SKPIS++PVP+HQHIAHLIL+QKS SQA+QTF+WAS LP+F H QSTYRAL+HKLC Sbjct: 79 VNLQSKPISTTPVPTHQHIAHLILEQKSASQALQTFRWASNLPNFIHNQSTYRALIHKLC 138 Query: 363 VFRCFD 380 FR F+ Sbjct: 139 SFRRFE 144 >ref|XP_002521729.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539120|gb|EEF40716.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 629 Score = 96.7 bits (239), Expect = 2e-18 Identities = 50/89 (56%), Positives = 57/89 (64%) Frame = +3 Query: 114 MPILLHPSKLPIFLTKPTFHILSLTFHSKPISSSPVPSHQHIAHLILDQKSPSQAIQTFK 293 MP L P KL +K + S S VPSHQHIAHLILDQ S ++A+QTFK Sbjct: 1 MPKLFPPLKLKATASKLLDIFQFRRYSSSSTPSLSVPSHQHIAHLILDQNSATKALQTFK 60 Query: 294 WASKLPHFTHTQSTYRALVHKLCVFRCFD 380 WAS LP FTH+QSTYRAL+ KLC F FD Sbjct: 61 WASNLPKFTHSQSTYRALIQKLCAFHRFD 89 >ref|XP_002307219.1| predicted protein [Populus trichocarpa] gi|222856668|gb|EEE94215.1| predicted protein [Populus trichocarpa] Length = 584 Score = 89.7 bits (221), Expect = 2e-16 Identities = 41/59 (69%), Positives = 48/59 (81%) Frame = +3 Query: 201 PISSSPVPSHQHIAHLILDQKSPSQAIQTFKWASKLPHFTHTQSTYRALVHKLCVFRCF 377 P S VP+H+ I HLILDQKS QA+QTF+WASKLP+FTH+QSTYRAL+HKL FR F Sbjct: 6 PTPSLAVPTHERIVHLILDQKSAPQALQTFEWASKLPNFTHSQSTYRALIHKLLTFRRF 64 >ref|XP_003516519.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Glycine max] Length = 618 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/75 (53%), Positives = 54/75 (72%) Frame = +3 Query: 156 TKPTFHILSLTFHSKPISSSPVPSHQHIAHLILDQKSPSQAIQTFKWASKLPHFTHTQST 335 + PT + F + SSS PS +H++ LILDQKS S+A++ F+WAS +P+F H+QST Sbjct: 13 SSPTHFLRRFQFQTHS-SSSSAPSQEHVSQLILDQKSASEALEYFRWASTVPNFVHSQST 71 Query: 336 YRALVHKLCVFRCFD 380 YRAL+HKLC FR FD Sbjct: 72 YRALIHKLCTFRRFD 86 >ref|XP_003612374.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513709|gb|AES95332.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 620 Score = 82.0 bits (201), Expect = 5e-14 Identities = 36/58 (62%), Positives = 45/58 (77%) Frame = +3 Query: 207 SSSPVPSHQHIAHLILDQKSPSQAIQTFKWASKLPHFTHTQSTYRALVHKLCVFRCFD 380 SSS P+ H+ LILDQK+ S+A+QTF+WAS FTH+QSTYR L+HKLC+FR FD Sbjct: 31 SSSLPPTQDHLCQLILDQKTSSEALQTFRWASTFSKFTHSQSTYRTLIHKLCIFRRFD 88