BLASTX nr result
ID: Angelica23_contig00030581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030581 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK94331.1| unknown [Populus trichocarpa] 87 1e-15 gb|ADR71296.1| stress-induced hydrophobic peptide 1 [Hevea brasi... 87 2e-15 ref|XP_003519155.1| PREDICTED: UPF0057 membrane protein At4g3066... 87 2e-15 ref|XP_002529408.1| Hydrophobic protein OSR8, putative [Ricinus ... 86 3e-15 ref|XP_002325125.1| stress-induced hydrophobic peptide [Populus ... 86 4e-15 >gb|ABK94331.1| unknown [Populus trichocarpa] Length = 77 Score = 87.4 bits (215), Expect = 1e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +3 Query: 168 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNRDVY 296 GVCFRHGCCSVEF+ICLLLT+LGYVPGIIYALYAIVF++RD Y Sbjct: 21 GVCFRHGCCSVEFWICLLLTILGYVPGIIYALYAIVFIDRDEY 63 >gb|ADR71296.1| stress-induced hydrophobic peptide 1 [Hevea brasiliensis] Length = 75 Score = 86.7 bits (213), Expect = 2e-15 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +3 Query: 168 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNRDVY 296 GVCFRHGCCSVEF ICLLLT+LGYVPGIIYALYAIVFV+RD Y Sbjct: 21 GVCFRHGCCSVEFCICLLLTILGYVPGIIYALYAIVFVDRDEY 63 >ref|XP_003519155.1| PREDICTED: UPF0057 membrane protein At4g30660 [Glycine max] gi|255628505|gb|ACU14597.1| unknown [Glycine max] Length = 75 Score = 86.7 bits (213), Expect = 2e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 168 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNRDVY 296 GVCFRHGCCSVEF ICLLLT+LGY+PGIIYALYAI+FV+RD Y Sbjct: 21 GVCFRHGCCSVEFIICLLLTILGYIPGIIYALYAIIFVDRDQY 63 >ref|XP_002529408.1| Hydrophobic protein OSR8, putative [Ricinus communis] gi|223531156|gb|EEF33004.1| Hydrophobic protein OSR8, putative [Ricinus communis] Length = 75 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +3 Query: 168 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNRDVY 296 GVC RHGCCSVEF+ICLLLT+LGYVPGIIYALYAIVFVNRD + Sbjct: 21 GVCLRHGCCSVEFWICLLLTILGYVPGIIYALYAIVFVNRDEF 63 >ref|XP_002325125.1| stress-induced hydrophobic peptide [Populus trichocarpa] gi|222866559|gb|EEF03690.1| stress-induced hydrophobic peptide [Populus trichocarpa] Length = 54 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 168 GVCFRHGCCSVEFFICLLLTMLGYVPGIIYALYAIVFVNRD 290 GVCFRHGCCSVEF+ICLLLT+LGYVPGIIYALYAIVF++RD Sbjct: 14 GVCFRHGCCSVEFWICLLLTILGYVPGIIYALYAIVFIDRD 54