BLASTX nr result
ID: Angelica23_contig00030571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030571 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002332551.1| cc-nbs-lrr resistance protein [Populus trich... 67 2e-09 ref|XP_002272291.1| PREDICTED: putative disease resistance prote... 64 1e-08 ref|XP_002523984.1| leucine-rich repeat containing protein, puta... 64 2e-08 ref|XP_002275171.1| PREDICTED: putative disease resistance prote... 64 2e-08 gb|ADB43255.1| blight resistance protein [Capsicum annuum] 62 4e-08 >ref|XP_002332551.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222833027|gb|EEE71504.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1210 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/62 (51%), Positives = 40/62 (64%), Gaps = 3/62 (4%) Frame = -2 Query: 290 SLKELFIENCGILESLPT---FDESHTLEHLRIYGCPVLIERCRKESGPEWFKIQHIPYV 120 SL+ L + NC L+ LP+ LEHLRI+GCP L E CRKE+G EW KI HIP + Sbjct: 1094 SLQSLIVSNCKNLKYLPSSTAIQRLSNLEHLRIWGCPHLSENCRKENGSEWPKISHIPTI 1153 Query: 119 YL 114 Y+ Sbjct: 1154 YI 1155 >ref|XP_002272291.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Length = 1490 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/58 (58%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -2 Query: 290 SLKELFIENCGILES-LPTFDESHTLEHLRIYGCPVLIERCRKESGPEWFKIQHIPYV 120 SLK L I C L+S LPT S TL L I GCP+LI+RC KE G +W KI HIPYV Sbjct: 1423 SLKSLCISRCPNLQSFLPTEGLSDTLSELSINGCPLLIQRCLKEKGEDWPKIAHIPYV 1480 >ref|XP_002523984.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223536711|gb|EEF38352.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1143 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = -2 Query: 290 SLKELFIENCGILESLPTFDESHTLEHLRIYGCPVLIERCRKESGPEWFKIQHI 129 SLK+L+IE+C +L S P +L+HL I CP L ERC+KE+GPEW KI++I Sbjct: 1059 SLKDLYIEDCPLLHSFPEDGLPTSLQHLYIQKCPKLTERCKKEAGPEWPKIENI 1112 >ref|XP_002275171.1| PREDICTED: putative disease resistance protein RGA4 [Vitis vinifera] Length = 1154 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/57 (52%), Positives = 41/57 (71%), Gaps = 2/57 (3%) Frame = -2 Query: 290 SLKELFIENCGILESLPTFDESHTLEHLRIYGCPVLIERCRKE--SGPEWFKIQHIP 126 SLK+L+IE+C L+ LP +LEHL I GCP+L+E+CRKE GP+W K++ IP Sbjct: 1057 SLKDLYIEDCPKLKCLPEKGVPTSLEHLVIQGCPLLMEQCRKEGGGGPDWLKVKDIP 1113 >gb|ADB43255.1| blight resistance protein [Capsicum annuum] Length = 994 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = -2 Query: 290 SLKELFIENCGILESLPTFDESHT-LEHLRIYGCPVLIERCRKESGPEWFKIQHIPYVYL 114 SL ELF+E+C +L+SLP + T L +LR+ GCP + +RC + +G +W KI HIP VY+ Sbjct: 934 SLMELFVEHCNMLKSLPEALQHLTALTNLRVTGCPEVAKRCERGTGEDWHKIAHIPNVYI 993