BLASTX nr result
ID: Angelica23_contig00030569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030569 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528440.1| Disease resistance protein RPP8, putative [R... 55 8e-06 >ref|XP_002528440.1| Disease resistance protein RPP8, putative [Ricinus communis] gi|223532116|gb|EEF33923.1| Disease resistance protein RPP8, putative [Ricinus communis] Length = 920 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/65 (43%), Positives = 43/65 (66%) Frame = -2 Query: 431 DAYTGDKMVCSADAFPCLQFLTVICFGNLRELQVDDGAVPSLKAFKILHCPLIKMDRIPQ 252 D+Y G KMVCS + FPCL+ L + +L+E +V +GA+PSL+ I + P +KM IP+ Sbjct: 815 DSYNGSKMVCSVNGFPCLEILEITGL-DLQEWEVTEGAMPSLRMLYIRNLPRLKM--IPE 871 Query: 251 RVKSL 237 + S+ Sbjct: 872 GLMSI 876