BLASTX nr result
ID: Angelica23_contig00030485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030485 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG37638.1| transposase [Populus trichocarpa] 82 5e-14 ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus c... 67 2e-09 >gb|ABG37638.1| transposase [Populus trichocarpa] Length = 1450 Score = 82.0 bits (201), Expect = 5e-14 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = +2 Query: 209 GDEGLLQSRKQPEIREGSLWKRSPVTKVSLLPFDYVVTLTESNP*T 346 GDE LLQSRKQPE R G LWKRSPVTK SLLPFDYVVTLTESNP T Sbjct: 30 GDERLLQSRKQPETRRGRLWKRSPVTKASLLPFDYVVTLTESNPQT 75 >ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081995|gb|AEY81187.1| orf49 (mitochondrion) [Daucus carota subsp. sativus] Length = 161 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 187 SDFFRLVGRRRATSI*KTAGNSRGQPLETFTGNQSVTPSF 306 + FFRLVGRR+ATSI KTAGN RG PLE F GNQSVTPSF Sbjct: 122 ASFFRLVGRRKATSIYKTAGNLRGSPLEAFAGNQSVTPSF 161