BLASTX nr result
ID: Angelica23_contig00030484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030484 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEB15968.1| ABA 8'-hydroxylase CYPA4 variant 1 [Solanum tuber... 69 3e-10 gb|AEB15967.1| ABA 8'-hydroxylase CYPA4 [Solanum tuberosum] 69 3e-10 gb|AED99877.1| cytochrome P450 [Panax notoginseng] 69 5e-10 ref|XP_002523575.1| cytochrome P450, putative [Ricinus communis]... 69 5e-10 ref|XP_002282788.1| PREDICTED: abscisic acid 8'-hydroxylase 4 [V... 68 9e-10 >gb|AEB15968.1| ABA 8'-hydroxylase CYPA4 variant 1 [Solanum tuberosum] Length = 478 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 167 PPGSMGLPYVGETLQMYSDNPSVLFATKQKRYGDIFK 277 PPGSMG PY+GETLQ+YS +PSV FA KQKRYGDIFK Sbjct: 40 PPGSMGWPYIGETLQLYSQDPSVFFANKQKRYGDIFK 76 >gb|AEB15967.1| ABA 8'-hydroxylase CYPA4 [Solanum tuberosum] Length = 500 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 167 PPGSMGLPYVGETLQMYSDNPSVLFATKQKRYGDIFK 277 PPGSMG PY+GETLQ+YS +PSV FA KQKRYGDIFK Sbjct: 40 PPGSMGWPYIGETLQLYSQDPSVFFANKQKRYGDIFK 76 >gb|AED99877.1| cytochrome P450 [Panax notoginseng] Length = 471 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 167 PPGSMGLPYVGETLQMYSDNPSVLFATKQKRYGDIFK 277 PPGSMG PY+GETLQ+YS +PSV F TKQ+RYGDIFK Sbjct: 37 PPGSMGWPYIGETLQLYSQDPSVFFTTKQRRYGDIFK 73 >ref|XP_002523575.1| cytochrome P450, putative [Ricinus communis] gi|223537137|gb|EEF38770.1| cytochrome P450, putative [Ricinus communis] Length = 470 Score = 68.6 bits (166), Expect = 5e-10 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = +2 Query: 167 PPGSMGLPYVGETLQMYSDNPSVLFATKQKRYGDIFK 277 PPGSMGLPY+G+TLQ+YS NP++ FA++QKRYG+IFK Sbjct: 31 PPGSMGLPYIGDTLQLYSQNPNIFFASRQKRYGEIFK 67 >ref|XP_002282788.1| PREDICTED: abscisic acid 8'-hydroxylase 4 [Vitis vinifera] Length = 470 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 167 PPGSMGLPYVGETLQMYSDNPSVLFATKQKRYGDIFK 277 PPGSMG PY+GETLQ+YS +PSV FA KQKRYG+IFK Sbjct: 36 PPGSMGWPYIGETLQLYSQDPSVFFAAKQKRYGEIFK 72