BLASTX nr result
ID: Angelica23_contig00030378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030378 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534671.1| hypothetical protein RCOM_2090500 [Ricinus c... 97 1e-18 ref|XP_002266973.2| PREDICTED: U-box domain-containing protein 3... 84 9e-15 emb|CBI38656.3| unnamed protein product [Vitis vinifera] 84 9e-15 emb|CAN78862.1| hypothetical protein VITISV_021538 [Vitis vinifera] 84 9e-15 ref|NP_194246.2| U-box domain-containing protein 35 [Arabidopsis... 82 3e-14 >ref|XP_002534671.1| hypothetical protein RCOM_2090500 [Ricinus communis] gi|223524795|gb|EEF27713.1| hypothetical protein RCOM_2090500 [Ricinus communis] Length = 364 Score = 97.1 bits (240), Expect = 1e-18 Identities = 46/80 (57%), Positives = 55/80 (68%) Frame = +2 Query: 140 GLLVTPPXXXXXXXXXXXXXKQVVQWALEKFDREDNVLFKLLHIRPKITTVPTSMGNFIP 319 GL PP K VV WALEKF ++NV+FKLLH+RPKIT VPT MGNFIP Sbjct: 14 GLPPIPPLTVGIAIDGKRKSKYVVYWALEKFIPKENVVFKLLHVRPKITAVPTPMGNFIP 73 Query: 320 MSEVRDDVGATYTREVEWQT 379 +S++RDDV A Y +E+EWQT Sbjct: 74 VSQIRDDVAAAYRKEMEWQT 93 >ref|XP_002266973.2| PREDICTED: U-box domain-containing protein 35-like [Vitis vinifera] Length = 804 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = +2 Query: 200 KQVVQWALEKFDREDNVLFKLLHIRPKITTVPTSMGNFIPMSEVRDDVGATYTREVEWQT 379 K VV+WALEKF E +FK+LH+RPKIT+VPT MGN IP+S+VRDDV A Y E+ WQT Sbjct: 34 KYVVRWALEKFVPEGLHMFKMLHVRPKITSVPTPMGNSIPLSQVRDDVAAAYLEEMGWQT 93 >emb|CBI38656.3| unnamed protein product [Vitis vinifera] Length = 784 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = +2 Query: 200 KQVVQWALEKFDREDNVLFKLLHIRPKITTVPTSMGNFIPMSEVRDDVGATYTREVEWQT 379 K VV+WALEKF E +FK+LH+RPKIT+VPT MGN IP+S+VRDDV A Y E+ WQT Sbjct: 34 KYVVRWALEKFVPEGLHMFKMLHVRPKITSVPTPMGNSIPLSQVRDDVAAAYLEEMGWQT 93 >emb|CAN78862.1| hypothetical protein VITISV_021538 [Vitis vinifera] Length = 804 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = +2 Query: 200 KQVVQWALEKFDREDNVLFKLLHIRPKITTVPTSMGNFIPMSEVRDDVGATYTREVEWQT 379 K VV+WALEKF E +FK+LH+RPKIT+VPT MGN IP+S+VRDDV A Y E+ WQT Sbjct: 34 KYVVRWALEKFVPEGLHMFKMLHVRPKITSVPTPMGNSIPLSQVRDDVAAAYLEEMGWQT 93 >ref|NP_194246.2| U-box domain-containing protein 35 [Arabidopsis thaliana] gi|172044784|sp|Q9SW11.2|PUB35_ARATH RecName: Full=U-box domain-containing protein 35; AltName: Full=Plant U-box protein 35; Includes: RecName: Full=E3 ubiquitin ligase; Includes: RecName: Full=Serine/threonine-protein kinase gi|332659618|gb|AEE85018.1| U-box domain-containing protein 35 [Arabidopsis thaliana] Length = 835 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/61 (63%), Positives = 46/61 (75%) Frame = +2 Query: 200 KQVVQWALEKFDREDNVLFKLLHIRPKITTVPTSMGNFIPMSEVRDDVGATYTREVEWQT 379 K VV WA+EKF E NV FKLLHI P IT+VPT MGN IP+SEVRDDV Y +E+ WQ+ Sbjct: 33 KYVVTWAIEKFATEGNVGFKLLHIHPMITSVPTPMGNAIPISEVRDDVVTAYRQEILWQS 92 Query: 380 D 382 + Sbjct: 93 E 93