BLASTX nr result
ID: Angelica23_contig00030005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00030005 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532249.1| pentatricopeptide repeat-containing protein,... 92 5e-23 emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] 81 1e-21 ref|XP_004139864.1| PREDICTED: putative pentatricopeptide repeat... 74 1e-20 ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat... 80 2e-20 ref|XP_002885074.1| pentatricopeptide repeat-containing protein ... 80 3e-19 >ref|XP_002532249.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528067|gb|EEF30143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 92.4 bits (228), Expect(2) = 5e-23 Identities = 47/74 (63%), Positives = 61/74 (82%) Frame = -1 Query: 306 WVSRGEHGREYLPGTGAYNEILDVLGKMKRFDELHQVLDEMSERKNGVFSEITYRIVVNR 127 WVS+G + L G+GAYNEILD+LGKM+RFDEL QVLD MS+R+ G+ +E TYR++VNR Sbjct: 103 WVSKGG---KVLMGSGAYNEILDILGKMRRFDELSQVLDIMSKRE-GLVNEETYRVLVNR 158 Query: 126 YAAAHRLDEATEFF 85 YAAAH+++EA E F Sbjct: 159 YAAAHKVEEAIEIF 172 Score = 40.0 bits (92), Expect(2) = 5e-23 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -2 Query: 95 LSFFYRRAQFGLRLDLIAFQTLLLALCRYKH 3 + F R GL +DL++FQ LL+ LCRYKH Sbjct: 169 IEIFNTRRDIGLEIDLVSFQNLLMFLCRYKH 199 >emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] Length = 546 Score = 80.9 bits (198), Expect(2) = 1e-21 Identities = 38/74 (51%), Positives = 54/74 (72%) Frame = -1 Query: 306 WVSRGEHGREYLPGTGAYNEILDVLGKMKRFDELHQVLDEMSERKNGVFSEITYRIVVNR 127 W SR Y PG G +NEILD+LG+M+RF E+ Q+ DEMS+RK G+ +E T+ +++NR Sbjct: 141 WASRCGXESGYSPGCGVHNEILDILGRMRRFHEMTQLFDEMSKRK-GLXNERTFGVLLNR 199 Query: 126 YAAAHRLDEATEFF 85 YAAAH+ +EA + F Sbjct: 200 YAAAHKTEEAVKIF 213 Score = 47.4 bits (111), Expect(2) = 1e-21 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = -2 Query: 95 LSFFYRRAQFGLRLDLIAFQTLLLALCRYKH 3 + FY+R G LDLIAFQTLL++LCRYKH Sbjct: 210 VKIFYKRKGLGFELDLIAFQTLLMSLCRYKH 240 >ref|XP_004139864.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Cucumis sativus] gi|449502917|ref|XP_004161779.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Cucumis sativus] Length = 532 Score = 74.3 bits (181), Expect(2) = 1e-20 Identities = 37/75 (49%), Positives = 55/75 (73%), Gaps = 1/75 (1%) Frame = -1 Query: 306 WV-SRGEHGREYLPGTGAYNEILDVLGKMKRFDELHQVLDEMSERKNGVFSEITYRIVVN 130 WV RG + ++ PG+ YNEIL +LGK +RF+E+ +VL EMS+RK + +E TY +++N Sbjct: 146 WVLKRGTNEEKFTPGSVIYNEILVILGKFRRFEEVDKVLVEMSKRKE-LVNEETYSVLLN 204 Query: 129 RYAAAHRLDEATEFF 85 RYAAAH+++EA F Sbjct: 205 RYAAAHKVEEAISIF 219 Score = 50.1 bits (118), Expect(2) = 1e-20 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -2 Query: 95 LSFFYRRAQFGLRLDLIAFQTLLLALCRYKH 3 +S FYRR +FGL ++LIAFQ+LL+ LCRYKH Sbjct: 216 ISIFYRRQEFGLEMNLIAFQSLLMWLCRYKH 246 >ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Vitis vinifera] Length = 546 Score = 80.1 bits (196), Expect(2) = 2e-20 Identities = 38/74 (51%), Positives = 54/74 (72%) Frame = -1 Query: 306 WVSRGEHGREYLPGTGAYNEILDVLGKMKRFDELHQVLDEMSERKNGVFSEITYRIVVNR 127 W SR Y PG G +NEILD+LG+M+RF E+ Q+ DEMS+RK G+ +E T+ +++NR Sbjct: 141 WASRCGIESGYSPGCGVHNEILDILGRMRRFHEMTQLFDEMSKRK-GLVNERTFGVLLNR 199 Query: 126 YAAAHRLDEATEFF 85 YAAAH+ +EA + F Sbjct: 200 YAAAHKTEEAVKIF 213 Score = 43.9 bits (102), Expect(2) = 2e-20 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 95 LSFFYRRAQFGLRLDLIAFQTLLLALCRYKH 3 + F +R G LDLIAFQTLL++LCRYKH Sbjct: 210 VKIFNKRKGLGFELDLIAFQTLLMSLCRYKH 240 >ref|XP_002885074.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330914|gb|EFH61333.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 517 Score = 80.1 bits (196), Expect(2) = 3e-19 Identities = 38/64 (59%), Positives = 50/64 (78%) Frame = -1 Query: 276 YLPGTGAYNEILDVLGKMKRFDELHQVLDEMSERKNGVFSEITYRIVVNRYAAAHRLDEA 97 Y+ + YNEILDVLGKM+RF+E HQV+DEMS+R +G E TY +++NRYAAAH++DEA Sbjct: 133 YISSSLVYNEILDVLGKMRRFEEFHQVVDEMSKR-DGFVDEKTYEVLLNRYAAAHKVDEA 191 Query: 96 TEFF 85 F Sbjct: 192 VGVF 195 Score = 39.7 bits (91), Expect(2) = 3e-19 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 86 FYRRAQFGLRLDLIAFQTLLLALCRYKH 3 F RR +FG+ DL+AF LL+ LCRYKH Sbjct: 195 FERRREFGIEDDLVAFHGLLMWLCRYKH 222