BLASTX nr result
ID: Angelica23_contig00029334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00029334 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139341.1| PREDICTED: arabinogalactan peptide 22-like [... 57 2e-06 >ref|XP_004139341.1| PREDICTED: arabinogalactan peptide 22-like [Cucumis sativus] gi|449521078|ref|XP_004167558.1| PREDICTED: arabinogalactan peptide 22-like [Cucumis sativus] Length = 63 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/66 (39%), Positives = 42/66 (63%) Frame = +2 Query: 77 MKSMRSLALVILGFMFMMIMQQQLVHAQDFSPAPAPNDPMSDGSTIDQGVAYFXXXXXXX 256 M S++ A+ I+GF+F++++Q H+ D SPA P+ +DG+ IDQG+AY Sbjct: 1 MSSLKLTAVPIVGFLFLIVLQLAHGHSHDISPAAGPS---NDGAAIDQGIAYVLLLLALA 57 Query: 257 ITYLVH 274 +TY+VH Sbjct: 58 VTYIVH 63